BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30621 (813 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 24 1.5 DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor pro... 23 4.4 DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor pro... 23 4.4 AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled rec... 23 4.4 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 24.2 bits (50), Expect = 1.5 Identities = 13/36 (36%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Frame = +3 Query: 399 LDKYLIPSSQTGESKVFYYKMKGDYH-RYLAEFATG 503 +D+ L+P SQ + VF + YH R +AE G Sbjct: 924 IDRVLVPGSQQNVAGVFNLRPATTYHLRIVAENEIG 959 Score = 22.2 bits (45), Expect = 5.9 Identities = 9/28 (32%), Positives = 12/28 (42%) Frame = -3 Query: 736 SEKRCPSFGDSFRRKAAFWRSPAGAVPG 653 S+ R D F + W+ AG PG Sbjct: 694 SDARVECKADGFPKPQVTWKKAAGDTPG 721 >DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 22.6 bits (46), Expect = 4.4 Identities = 18/53 (33%), Positives = 22/53 (41%), Gaps = 3/53 (5%) Frame = -1 Query: 753 LCKFFPP---RSVVQVSAIASVERRPFGEARQARFRAVQDLVSRTRKKFEREV 604 L FF P S+V + + RR ARQ+R AVQ R E V Sbjct: 202 LGSFFIPLLLMSLVYLEIYLATRRRLRERARQSRINAVQSTRHREADDAEESV 254 >DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 22.6 bits (46), Expect = 4.4 Identities = 18/53 (33%), Positives = 22/53 (41%), Gaps = 3/53 (5%) Frame = -1 Query: 753 LCKFFPP---RSVVQVSAIASVERRPFGEARQARFRAVQDLVSRTRKKFEREV 604 L FF P S+V + + RR ARQ+R AVQ R E V Sbjct: 202 LGSFFIPLLLMSLVYLEIYLATRRRLRERARQSRINAVQSTRHREADDAEESV 254 >AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled receptor protein. Length = 399 Score = 22.6 bits (46), Expect = 4.4 Identities = 18/53 (33%), Positives = 22/53 (41%), Gaps = 3/53 (5%) Frame = -1 Query: 753 LCKFFPP---RSVVQVSAIASVERRPFGEARQARFRAVQDLVSRTRKKFEREV 604 L FF P S+V + + RR ARQ+R AVQ R E V Sbjct: 202 LGSFFIPLLLMSLVYLEIYLATRRRLRERARQSRINAVQSTRHREADDAEESV 254 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 222,917 Number of Sequences: 438 Number of extensions: 4823 Number of successful extensions: 9 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25853301 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -