BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30620 (481 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY043293-1|AAK96033.1| 523|Tribolium castaneum homeodomain tran... 23 1.9 AF187069-1|AAF03889.1| 471|Tribolium castaneum proboscipedia or... 23 1.9 AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxida... 22 2.6 AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain tran... 22 2.6 DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 21 5.9 >AY043293-1|AAK96033.1| 523|Tribolium castaneum homeodomain transcription factor Maxillopediaprotein. Length = 523 Score = 22.6 bits (46), Expect = 1.9 Identities = 11/36 (30%), Positives = 14/36 (38%) Frame = +3 Query: 288 QGLHGTHLRHEVEQRVHNRQGHEGVHLAAARQGHPP 395 QG G H + ++ G E HL GH P Sbjct: 379 QGYQGEHPNYNHYGYHYSGDGGEVAHLPNTHMGHEP 414 >AF187069-1|AAF03889.1| 471|Tribolium castaneum proboscipedia ortholog protein. Length = 471 Score = 22.6 bits (46), Expect = 1.9 Identities = 11/36 (30%), Positives = 14/36 (38%) Frame = +3 Query: 288 QGLHGTHLRHEVEQRVHNRQGHEGVHLAAARQGHPP 395 QG G H + ++ G E HL GH P Sbjct: 327 QGYQGEHPNYNHYGYHYSGDGGEVAHLPNTHMGHEP 362 >AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxidase subunit 1 protein. Length = 682 Score = 22.2 bits (45), Expect = 2.6 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = -2 Query: 207 IIHKFPDSNLMKSIIFVVAMSNWMESL 127 II +F L + VV +SNW E L Sbjct: 239 IIARFNIERLCNGLKRVVKLSNWREPL 265 >AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain transcription factor Prothoraxlessprotein. Length = 323 Score = 22.2 bits (45), Expect = 2.6 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +3 Query: 378 RQGHPPHHRRG 410 RQG PPHH G Sbjct: 57 RQGIPPHHYGG 67 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 21.0 bits (42), Expect = 5.9 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = +3 Query: 9 RRLSTSCVKSSVWRPDLRMFR 71 R+++ C+KS WR L + + Sbjct: 525 RKVTFQCLKSIAWRAFLAVLK 545 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 122,513 Number of Sequences: 336 Number of extensions: 3035 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 11247091 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -