BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30616 (747 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_05_0239 + 22244565-22245144,22245249-22245594,22246847-222468... 29 5.2 >03_05_0239 + 22244565-22245144,22245249-22245594,22246847-22246868, 22246982-22247054,22247131-22247233,22247312-22247366, 22247448-22247542,22247913-22248204,22248292-22248495, 22248583-22248615 Length = 600 Score = 28.7 bits (61), Expect = 5.2 Identities = 23/84 (27%), Positives = 39/84 (46%), Gaps = 2/84 (2%) Frame = -1 Query: 687 KPWSLQASYCRGIGFGDVGNIS*FYMFEANGHRESPDFLYIEIVKPIL*LGAVITVHFML 508 KPW++ C + GD+G+ + +G R SPD + P L G ++T + Sbjct: 467 KPWNIFLGPCGAVRIGDLGH-GCWSKSYCDGRRGSPDCGTMLYSAPELRNGLLVTDKVDV 525 Query: 507 YNL--IKCEIMSISISSIKVRLSS 442 Y+L I EI + S+ R+ + Sbjct: 526 YSLGVIYLEIFMPAAVSVNNRVDA 549 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,834,961 Number of Sequences: 37544 Number of extensions: 301467 Number of successful extensions: 461 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 455 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 461 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1980691104 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -