BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30611 (778 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_49296| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 8e-21 SB_34890| Best HMM Match : DnaJ (HMM E-Value=2.7e-37) 54 2e-07 SB_16146| Best HMM Match : DnaJ (HMM E-Value=2.7e-37) 54 2e-07 SB_21966| Best HMM Match : DnaJ (HMM E-Value=5.30001e-40) 53 3e-07 SB_39063| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_43852| Best HMM Match : DnaJ (HMM E-Value=1.7e-37) 48 6e-06 SB_293| Best HMM Match : DnaJ (HMM E-Value=7.6e-37) 46 3e-05 SB_20922| Best HMM Match : RVT_1 (HMM E-Value=0) 46 3e-05 SB_31923| Best HMM Match : DnaJ (HMM E-Value=2.8e-38) 44 2e-04 SB_3383| Best HMM Match : DnaJ (HMM E-Value=3.8e-40) 43 3e-04 SB_21898| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_41006| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.016 SB_2261| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.016 SB_59454| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_42340| Best HMM Match : DnaJ (HMM E-Value=3.2e-32) 36 0.048 SB_2842| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_34242| Best HMM Match : DnaJ (HMM E-Value=9.2e-30) 31 1.0 SB_11933| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_37512| Best HMM Match : DnaJ (HMM E-Value=1.3e-29) 31 1.0 SB_59661| Best HMM Match : PMP22_Claudin (HMM E-Value=0.26) 31 1.4 SB_21411| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_257| Best HMM Match : Tetraspannin (HMM E-Value=1.5) 30 2.4 SB_39666| Best HMM Match : Fe-ADH (HMM E-Value=0.59) 29 3.2 SB_31743| Best HMM Match : IncA (HMM E-Value=1.4) 29 4.2 SB_20223| Best HMM Match : IncA (HMM E-Value=1.4) 29 4.2 SB_10713| Best HMM Match : Peptidase_C32 (HMM E-Value=3.3) 29 4.2 SB_47226| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_33591| Best HMM Match : DnaJ (HMM E-Value=0.0056) 29 4.2 SB_17511| Best HMM Match : Flagellin_IN (HMM E-Value=5.6) 29 4.2 SB_5262| Best HMM Match : IncA (HMM E-Value=2.1) 29 4.2 SB_58552| Best HMM Match : UbiD (HMM E-Value=1.1) 29 5.5 SB_23070| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.5 SB_45370| Best HMM Match : Flagellin_IN (HMM E-Value=6.9) 29 5.5 SB_36131| Best HMM Match : His_leader (HMM E-Value=2.7e-10) 29 5.5 SB_25594| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.5 SB_19157| Best HMM Match : FLO_LFY (HMM E-Value=0.27) 29 5.5 SB_16477| Best HMM Match : DnaJ (HMM E-Value=8.1e-33) 28 7.3 SB_6150| Best HMM Match : GAT (HMM E-Value=2.3e-34) 28 7.3 SB_48086| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.3 SB_14945| Best HMM Match : Herpes_US9 (HMM E-Value=1.7) 28 9.7 SB_8101| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.7 SB_2468| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.7 SB_7076| Best HMM Match : IncA (HMM E-Value=0.74) 28 9.7 >SB_49296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 966 Score = 97.9 bits (233), Expect = 8e-21 Identities = 60/170 (35%), Positives = 83/170 (48%) Frame = +1 Query: 238 P*QEPNEGEKFKQISQAYEVLSNPDKRRIYDQGGEQALKEXXXXXXXXXXPMDLFDMXXX 417 P + P+EG++FKQISQAYEVLS+ KR+IYD+GGE A+K PMD+FDM Sbjct: 94 PDKNPDEGDRFKQISQAYEVLSDEKKRKIYDEGGEDAIK-GGGEGGGFHSPMDIFDM--F 150 Query: 418 XXXXXXXXXXXXXXXDVIHQLSVTLEELYCAQSEN*RFKXXXXXXXXXXXXXXXXQFKLV 597 D++HQL VTLEELY + + + Sbjct: 151 FGTGRAAHQGERRGKDMVHQLRVTLEELYNGATRQLALQKNVICSKCDGRGGKEGCVESC 210 Query: 598 QCAVALVCKYKFQQLGPGMIQQIQTVCCECPWTKKRL*IPKRPFAKVCEG 747 Q + ++ PGM+QQIQTVC +C ++ IP++ K C G Sbjct: 211 QTCHGSGMYVRINRIAPGMVQQIQTVCRDCGGKGEK--IPEKDRCKNCHG 258 Score = 43.6 bits (98), Expect = 2e-04 Identities = 20/39 (51%), Positives = 20/39 (51%) Frame = +2 Query: 137 MVKETTYYDILGVKPNCTTDEXXXXXXXXXXXXHPDKNP 253 MVKET YYDIL V P T E HPDKNP Sbjct: 60 MVKETAYYDILNVPPTATATEIKKSYRKLALKYHPDKNP 98 >SB_34890| Best HMM Match : DnaJ (HMM E-Value=2.7e-37) Length = 386 Score = 53.6 bits (123), Expect = 2e-07 Identities = 22/40 (55%), Positives = 32/40 (80%) Frame = +1 Query: 238 P*QEPNEGEKFKQISQAYEVLSNPDKRRIYDQGGEQALKE 357 P + P+ GEKFK I+ AYE+LS+P+KR +YD+ GE+ L+E Sbjct: 34 PDKNPDTGEKFKDITFAYEILSDPEKRELYDRYGEKGLRE 73 Score = 31.5 bits (68), Expect = 0.79 Identities = 13/36 (36%), Positives = 18/36 (50%) Frame = +2 Query: 146 ETTYYDILGVKPNCTTDEXXXXXXXXXXXXHPDKNP 253 +T YD+LGV N + ++ HPDKNP Sbjct: 3 DTRLYDLLGVPQNASDNDIKKAYRKLAKELHPDKNP 38 Score = 31.1 bits (67), Expect = 1.0 Identities = 10/22 (45%), Positives = 17/22 (77%) Frame = +1 Query: 622 KYKFQQLGPGMIQQIQTVCCEC 687 K + +GPGM+QQ+Q++C +C Sbjct: 147 KVTIKPIGPGMVQQMQSMCHDC 168 >SB_16146| Best HMM Match : DnaJ (HMM E-Value=2.7e-37) Length = 79 Score = 53.6 bits (123), Expect = 2e-07 Identities = 22/40 (55%), Positives = 32/40 (80%) Frame = +1 Query: 238 P*QEPNEGEKFKQISQAYEVLSNPDKRRIYDQGGEQALKE 357 P + P+ GEKFK I+ AYE+LS+P+KR +YD+ GE+ L+E Sbjct: 34 PDKNPDTGEKFKDITFAYEILSDPEKRELYDRYGEKGLRE 73 Score = 31.5 bits (68), Expect = 0.79 Identities = 13/36 (36%), Positives = 18/36 (50%) Frame = +2 Query: 146 ETTYYDILGVKPNCTTDEXXXXXXXXXXXXHPDKNP 253 +T YD+LGV N + ++ HPDKNP Sbjct: 3 DTRLYDLLGVPQNASDNDIKKAYRKLAKELHPDKNP 38 >SB_21966| Best HMM Match : DnaJ (HMM E-Value=5.30001e-40) Length = 351 Score = 52.8 bits (121), Expect = 3e-07 Identities = 23/37 (62%), Positives = 29/37 (78%) Frame = +1 Query: 244 QEPNEGEKFKQISQAYEVLSNPDKRRIYDQGGEQALK 354 + P EKFK+IS+AYEVLS+P K+ IYDQ GE+ LK Sbjct: 37 KSPGAEEKFKEISEAYEVLSDPKKKEIYDQYGEEGLK 73 >SB_39063| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 350 Score = 52.4 bits (120), Expect = 4e-07 Identities = 22/37 (59%), Positives = 30/37 (81%) Frame = +1 Query: 244 QEPNEGEKFKQISQAYEVLSNPDKRRIYDQGGEQALK 354 ++P EKFK+I++AYEVLS+P KR I+DQ GE+ LK Sbjct: 37 KDPGAEEKFKEIAEAYEVLSDPQKREIFDQYGEEGLK 73 Score = 31.5 bits (68), Expect = 0.79 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = +2 Query: 155 YYDILGVKPNCTTDEXXXXXXXXXXXXHPDKN 250 YYDILGVK + + E HPDKN Sbjct: 5 YYDILGVKKDASDQELKKAYKKQAFKYHPDKN 36 >SB_43852| Best HMM Match : DnaJ (HMM E-Value=1.7e-37) Length = 399 Score = 48.4 bits (110), Expect = 6e-06 Identities = 21/37 (56%), Positives = 29/37 (78%) Frame = +1 Query: 244 QEPNEGEKFKQISQAYEVLSNPDKRRIYDQGGEQALK 354 QEP+ KF+Q ++AY+VLS+P KR IY+Q GE+ LK Sbjct: 37 QEPSAEVKFRQAAEAYDVLSDPKKRAIYNQFGEEGLK 73 >SB_293| Best HMM Match : DnaJ (HMM E-Value=7.6e-37) Length = 238 Score = 46.4 bits (105), Expect = 3e-05 Identities = 30/88 (34%), Positives = 37/88 (42%), Gaps = 2/88 (2%) Frame = +1 Query: 247 EPNEGEKFKQISQAYEVLSNPDKRRIYDQGGEQALKEXXXXXXXXXXPMDL--FDMXXXX 420 +P EKF I AYEVL++ D+R+IYDQ GE+ LK F Sbjct: 60 DPKAQEKFHDIGAAYEVLADDDQRKIYDQRGEEGLKNAGHRDHSDPFSSFFGGFGFHFDG 119 Query: 421 XXXXXXXXXXXXXXDVIHQLSVTLEELY 504 D+ L VTLEELY Sbjct: 120 HNGHSHSQQVPRGSDLTVDLEVTLEELY 147 >SB_20922| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 576 Score = 46.0 bits (104), Expect = 3e-05 Identities = 19/31 (61%), Positives = 27/31 (87%) Frame = +1 Query: 262 EKFKQISQAYEVLSNPDKRRIYDQGGEQALK 354 EKF+++++AYEVLS+ +KRR YDQ GE+ LK Sbjct: 65 EKFREVAEAYEVLSDENKRRQYDQFGEEGLK 95 >SB_31923| Best HMM Match : DnaJ (HMM E-Value=2.8e-38) Length = 161 Score = 43.6 bits (98), Expect = 2e-04 Identities = 21/41 (51%), Positives = 30/41 (73%), Gaps = 2/41 (4%) Frame = +1 Query: 238 P*QEPNEG--EKFKQISQAYEVLSNPDKRRIYDQGGEQALK 354 P + N G EKFK+IS+AY+VL++P +R I+D GE+ LK Sbjct: 33 PDKNKNSGAEEKFKEISEAYKVLTDPRQRDIFDMYGEEGLK 73 Score = 28.7 bits (61), Expect = 5.5 Identities = 13/32 (40%), Positives = 15/32 (46%) Frame = +2 Query: 155 YYDILGVKPNCTTDEXXXXXXXXXXXXHPDKN 250 YY ILGV N + D+ HPDKN Sbjct: 5 YYAILGVPRNASDDDIKKAYRRQALIFHPDKN 36 >SB_3383| Best HMM Match : DnaJ (HMM E-Value=3.8e-40) Length = 250 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/30 (60%), Positives = 26/30 (86%) Frame = +1 Query: 262 EKFKQISQAYEVLSNPDKRRIYDQGGEQAL 351 EKFK++S+AYEVLS+ +KR IYD+ G++ L Sbjct: 45 EKFKKLSEAYEVLSDKEKRDIYDKYGKEGL 74 Score = 29.1 bits (62), Expect = 4.2 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = +2 Query: 155 YYDILGVKPNCTTDEXXXXXXXXXXXXHPDKNP 253 YY++LGV + + ++ HPDKNP Sbjct: 5 YYEVLGVPRSASEEDVKKAYRRQALRWHPDKNP 37 >SB_21898| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1084 Score = 38.7 bits (86), Expect = 0.005 Identities = 15/33 (45%), Positives = 25/33 (75%) Frame = +1 Query: 244 QEPNEGEKFKQISQAYEVLSNPDKRRIYDQGGE 342 ++ + EKF+++S+AYEVLS+ KR+ YD G+ Sbjct: 92 KDKSASEKFQEVSEAYEVLSDDGKRKAYDSFGQ 124 Score = 28.3 bits (60), Expect = 7.3 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 155 YYDILGVKPNCTTDEXXXXXXXXXXXXHPDKN 250 YY ILGV PN E HPD N Sbjct: 60 YYKILGVPPNANQKEIKKAYFELAKKYHPDTN 91 >SB_41006| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 725 Score = 37.1 bits (82), Expect = 0.016 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = +2 Query: 146 ETTYYDILGVKPNCTTDEXXXXXXXXXXXXHPDKN 250 E+ YY++LGV+ N TTD+ HPDKN Sbjct: 2 ESNYYEVLGVERNATTDDIRRAYRRLALKYHPDKN 36 Score = 32.7 bits (71), Expect = 0.34 Identities = 12/24 (50%), Positives = 19/24 (79%) Frame = +1 Query: 262 EKFKQISQAYEVLSNPDKRRIYDQ 333 E FK++S+AYEVL +P +R +D+ Sbjct: 41 ENFKEVSEAYEVLCDPQQRERFDK 64 >SB_2261| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 572 Score = 37.1 bits (82), Expect = 0.016 Identities = 15/29 (51%), Positives = 22/29 (75%) Frame = +1 Query: 268 FKQISQAYEVLSNPDKRRIYDQGGEQALK 354 F++I QAY+VLS+P +R YD+ EQ L+ Sbjct: 47 FREIQQAYDVLSDPQERAFYDKHREQILR 75 >SB_59454| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 285 Score = 35.5 bits (78), Expect = 0.048 Identities = 12/25 (48%), Positives = 21/25 (84%) Frame = +1 Query: 262 EKFKQISQAYEVLSNPDKRRIYDQG 336 ++FK++++AY +LS+P K+R YD G Sbjct: 204 KQFKEVNEAYSILSDPKKKRRYDSG 228 >SB_42340| Best HMM Match : DnaJ (HMM E-Value=3.2e-32) Length = 264 Score = 35.5 bits (78), Expect = 0.048 Identities = 12/25 (48%), Positives = 21/25 (84%) Frame = +1 Query: 262 EKFKQISQAYEVLSNPDKRRIYDQG 336 ++FK++++AY +LS+P K+R YD G Sbjct: 204 KQFKEVNEAYSILSDPKKKRRYDSG 228 >SB_2842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 257 Score = 33.9 bits (74), Expect = 0.15 Identities = 13/26 (50%), Positives = 21/26 (80%) Frame = +1 Query: 265 KFKQISQAYEVLSNPDKRRIYDQGGE 342 KF+ +S++Y +LS+ +KR IYD+ GE Sbjct: 58 KFQALSKSYCILSDKEKRAIYDESGE 83 >SB_34242| Best HMM Match : DnaJ (HMM E-Value=9.2e-30) Length = 238 Score = 31.1 bits (67), Expect = 1.0 Identities = 12/25 (48%), Positives = 19/25 (76%) Frame = +1 Query: 262 EKFKQISQAYEVLSNPDKRRIYDQG 336 E F++I++AY VL N + R+ YD+G Sbjct: 112 EVFQEIAEAYSVLGNLESRKQYDRG 136 >SB_11933| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 238 Score = 31.1 bits (67), Expect = 1.0 Identities = 12/25 (48%), Positives = 19/25 (76%) Frame = +1 Query: 262 EKFKQISQAYEVLSNPDKRRIYDQG 336 E F++I++AY VL N + R+ YD+G Sbjct: 112 EVFQEIAEAYSVLGNLESRKQYDRG 136 >SB_37512| Best HMM Match : DnaJ (HMM E-Value=1.3e-29) Length = 291 Score = 31.1 bits (67), Expect = 1.0 Identities = 16/53 (30%), Positives = 22/53 (41%) Frame = +2 Query: 155 YYDILGVKPNCTTDEXXXXXXXXXXXXHPDKNPMRVRNLNRYLRPMRCSRILT 313 YYD LGV + T E HPDKNP + + + + +LT Sbjct: 8 YYDTLGVHKDSTEKEILKAYRKKALKCHPDKNPDNPKASELFHKLSKALEVLT 60 >SB_59661| Best HMM Match : PMP22_Claudin (HMM E-Value=0.26) Length = 680 Score = 30.7 bits (66), Expect = 1.4 Identities = 10/26 (38%), Positives = 18/26 (69%) Frame = -3 Query: 233 ILELIFDRLSLIHQWCNLVSRPKCHN 156 +++L F RLSL+ W N + + KC++ Sbjct: 219 VVDLYFSRLSLLESWKNFILQSKCYH 244 >SB_21411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 308 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/39 (33%), Positives = 18/39 (46%) Frame = +2 Query: 128 IIKMVKETTYYDILGVKPNCTTDEXXXXXXXXXXXXHPD 244 ++K ++ YY ILG+K NC E HPD Sbjct: 200 LLKQSQKRDYYKILGLKRNCNKREITKAYRKLAVKWHPD 238 Score = 28.3 bits (60), Expect = 7.3 Identities = 14/32 (43%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Frame = +1 Query: 244 QEPNEGEK-FKQISQAYEVLSNPDKRRIYDQG 336 ++ + EK F I+ A EVL++P+KR YD G Sbjct: 243 EDKKKAEKMFIDIAAAKEVLTDPEKRAKYDAG 274 >SB_257| Best HMM Match : Tetraspannin (HMM E-Value=1.5) Length = 237 Score = 29.9 bits (64), Expect = 2.4 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = -1 Query: 379 IHHHYHPLPLMLVHHLDH 326 +HHH+HPL + ++H H Sbjct: 154 VHHHHHPLSIAIIHRHRH 171 >SB_39666| Best HMM Match : Fe-ADH (HMM E-Value=0.59) Length = 483 Score = 29.5 bits (63), Expect = 3.2 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = -3 Query: 230 LELIFDRLSLIHQWCNLVSRPKCHNMWSP*PFLLCL 123 LE+ ++ I+ +C++V R KC + P L CL Sbjct: 64 LEVTLSKIEAIYIFCDIVDRTKCFALGEPSNVLACL 99 >SB_31743| Best HMM Match : IncA (HMM E-Value=1.4) Length = 330 Score = 29.1 bits (62), Expect = 4.2 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = -3 Query: 230 LELIFDRLSLIHQWCNLVSRPKCHNMWSP*PFLLCL 123 LE+ ++ I+ +C++V R KC + P L CL Sbjct: 64 LEVTLSKIEAIYVFCDIVDRTKCFALDEPSNVLACL 99 >SB_20223| Best HMM Match : IncA (HMM E-Value=1.4) Length = 400 Score = 29.1 bits (62), Expect = 4.2 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = -3 Query: 230 LELIFDRLSLIHQWCNLVSRPKCHNMWSP*PFLLCL 123 LE+ ++ I+ +C++V R KC + P L CL Sbjct: 134 LEVTLSKIEAIYVFCDIVDRTKCFALDEPSNVLACL 169 >SB_10713| Best HMM Match : Peptidase_C32 (HMM E-Value=3.3) Length = 615 Score = 29.1 bits (62), Expect = 4.2 Identities = 11/40 (27%), Positives = 23/40 (57%) Frame = -3 Query: 242 QGGILELIFDRLSLIHQWCNLVSRPKCHNMWSP*PFLLCL 123 +GG L++ ++ ++ C++V R +C ++ P L CL Sbjct: 560 EGGPLKMALTKIEALYICCDIVDRTQCLSLGEPSNVLACL 599 >SB_47226| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 351 Score = 29.1 bits (62), Expect = 4.2 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = -3 Query: 230 LELIFDRLSLIHQWCNLVSRPKCHNMWSP*PFLLCL 123 LE+ ++ I+ +C++V R KC + P L CL Sbjct: 64 LEVTLSKIEAIYIYCDIVDRTKCFALDEPSNVLACL 99 >SB_33591| Best HMM Match : DnaJ (HMM E-Value=0.0056) Length = 219 Score = 29.1 bits (62), Expect = 4.2 Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = +1 Query: 253 NEGEKFKQISQAYEVLSNPDKRRIYD 330 N +KF+ I+ AYE L +P++R YD Sbjct: 78 NAIKKFQLIATAYETLKDPEQRNDYD 103 >SB_17511| Best HMM Match : Flagellin_IN (HMM E-Value=5.6) Length = 265 Score = 29.1 bits (62), Expect = 4.2 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = -3 Query: 230 LELIFDRLSLIHQWCNLVSRPKCHNMWSP*PFLLCL 123 LE+ ++ I+ +C++V R KC + P L CL Sbjct: 102 LEVTLSKIEAIYIFCDIVDRTKCFALDEPSTVLACL 137 >SB_5262| Best HMM Match : IncA (HMM E-Value=2.1) Length = 597 Score = 29.1 bits (62), Expect = 4.2 Identities = 11/40 (27%), Positives = 23/40 (57%) Frame = -3 Query: 242 QGGILELIFDRLSLIHQWCNLVSRPKCHNMWSP*PFLLCL 123 +GG L++ ++ ++ C++V R +C ++ P L CL Sbjct: 280 EGGPLKMALTKIEALYICCDIVDRTQCLSLGEPSNVLACL 319 >SB_58552| Best HMM Match : UbiD (HMM E-Value=1.1) Length = 409 Score = 28.7 bits (61), Expect = 5.5 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = -3 Query: 230 LELIFDRLSLIHQWCNLVSRPKCHNMWSP*PFLLCL 123 LE+ ++ I+ +C++V R KC + P L CL Sbjct: 133 LEVTLSKIEAIYIFCDIVDRTKCFALDEPSNVLACL 168 >SB_23070| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1202 Score = 28.7 bits (61), Expect = 5.5 Identities = 11/39 (28%), Positives = 22/39 (56%) Frame = -3 Query: 239 GGILELIFDRLSLIHQWCNLVSRPKCHNMWSP*PFLLCL 123 GG L++ ++ ++ C++V R +C ++ P L CL Sbjct: 163 GGALKVALPKIEALYICCDIVDRTQCLSLGEPSNVLACL 201 >SB_45370| Best HMM Match : Flagellin_IN (HMM E-Value=6.9) Length = 226 Score = 28.7 bits (61), Expect = 5.5 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = -3 Query: 230 LELIFDRLSLIHQWCNLVSRPKCHNMWSP*PFLLCL 123 LE+ ++ I+ +C++V R KC + P L CL Sbjct: 133 LEVTLSKMEAIYIFCDIVDRKKCFALDEPSNVLACL 168 >SB_36131| Best HMM Match : His_leader (HMM E-Value=2.7e-10) Length = 416 Score = 28.7 bits (61), Expect = 5.5 Identities = 14/41 (34%), Positives = 20/41 (48%) Frame = -1 Query: 379 IHHHYHPLPLMLVHHLDHKFAFCQDSRAPHRPEISV*ISHP 257 IHHH+HP +++ H H + H P S+ I HP Sbjct: 152 IHHHHHPSSSIIIIHHHHPSSSSIIIIIHHHPS-SIIIHHP 191 Score = 28.7 bits (61), Expect = 5.5 Identities = 20/87 (22%), Positives = 36/87 (41%), Gaps = 4/87 (4%) Frame = -1 Query: 505 STTPPMLLIIDELHLCLCVPCGVYLH*IHLQRTCQRDPLVKKIHHHYHPLP----LMLVH 338 S++ +++II H + +H H + ++ IHHH+HP ++++H Sbjct: 270 SSSSSIIIIIHHHHHPSSSSSIIIIHHHHHPSSSSSIIIIIIIHHHHHPSSSSSIIIIIH 329 Query: 337 HLDHKFAFCQDSRAPHRPEISV*ISHP 257 H H S H P + HP Sbjct: 330 H--HHHPSSSSSIIHHHPSSIIIHHHP 354 >SB_25594| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1084 Score = 28.7 bits (61), Expect = 5.5 Identities = 11/39 (28%), Positives = 22/39 (56%) Frame = -3 Query: 239 GGILELIFDRLSLIHQWCNLVSRPKCHNMWSP*PFLLCL 123 GG L++ ++ ++ C++V R +C ++ P L CL Sbjct: 319 GGALKVALPKIEALYICCDIVDRTQCLSLGEPSNVLACL 357 >SB_19157| Best HMM Match : FLO_LFY (HMM E-Value=0.27) Length = 560 Score = 28.7 bits (61), Expect = 5.5 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = -3 Query: 230 LELIFDRLSLIHQWCNLVSRPKCHNMWSP*PFLLCL 123 LE+ ++ I+ +C++V R KC + P L CL Sbjct: 400 LEVTLSKIEAIYIFCDIVDRTKCFALDEPSNVLACL 435 >SB_16477| Best HMM Match : DnaJ (HMM E-Value=8.1e-33) Length = 138 Score = 28.3 bits (60), Expect = 7.3 Identities = 14/22 (63%), Positives = 17/22 (77%), Gaps = 1/22 (4%) Frame = +1 Query: 244 QEPNEGE-KFKQISQAYEVLSN 306 Q E E KFK+IS+AYEVLS+ Sbjct: 37 QNKEEAERKFKEISEAYEVLSD 58 Score = 27.9 bits (59), Expect = 9.7 Identities = 13/41 (31%), Positives = 16/41 (39%) Frame = +2 Query: 155 YYDILGVKPNCTTDEXXXXXXXXXXXXHPDKNPMRVRNLNR 277 YYDIL V + + + HPDKNP R Sbjct: 4 YYDILEVPRSASEQDIKKSYRKLALKWHPDKNPQNKEEAER 44 >SB_6150| Best HMM Match : GAT (HMM E-Value=2.3e-34) Length = 674 Score = 28.3 bits (60), Expect = 7.3 Identities = 19/71 (26%), Positives = 28/71 (39%), Gaps = 4/71 (5%) Frame = -1 Query: 670 FESAVSYPGLAVEICTCIPEPRHTGQV*TAPFLPPRPSHFSQITFF*SVS----FLTVHS 503 F A S P E PR + P +PPRP + + +TF + FL + Sbjct: 245 FRQAQSTPSTPTEPPRPAEPPRPSPAATAHPVMPPRPQNMTMVTFESILKYDHCFLVLQV 304 Query: 502 TTPPMLLIIDE 470 PP + D+ Sbjct: 305 PPPPATEVADD 315 >SB_48086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1353 Score = 28.3 bits (60), Expect = 7.3 Identities = 10/20 (50%), Positives = 16/20 (80%) Frame = +1 Query: 268 FKQISQAYEVLSNPDKRRIY 327 F ++ +AYEVLS+P+ + IY Sbjct: 202 FSKVQKAYEVLSDPETKAIY 221 >SB_14945| Best HMM Match : Herpes_US9 (HMM E-Value=1.7) Length = 292 Score = 27.9 bits (59), Expect = 9.7 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = -3 Query: 230 LELIFDRLSLIHQWCNLVSRPKCHNMWSP*PFLLCL 123 LE+ ++ I+ +C++V R KC P L CL Sbjct: 139 LEVTLSKIEAIYIFCDIVDRTKCFAFDEPSNVLACL 174 >SB_8101| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 464 Score = 27.9 bits (59), Expect = 9.7 Identities = 11/39 (28%), Positives = 22/39 (56%) Frame = -3 Query: 239 GGILELIFDRLSLIHQWCNLVSRPKCHNMWSP*PFLLCL 123 GG L++ ++ ++ +C++V R +C + P L CL Sbjct: 130 GGALKVTLPKIEALYIFCDIVDRSQCLALDEPSNVLACL 168 >SB_2468| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 27.9 bits (59), Expect = 9.7 Identities = 15/41 (36%), Positives = 25/41 (60%) Frame = -2 Query: 654 HTRA*LLKFVLAYQSHGTLDKFELHPFYHHVPHISHRSRSF 532 H+R+ ++ VLA + G +D F + F+ + + HRSRSF Sbjct: 142 HSRSFVVNLVLA-EFKGCID-FRRYCFHRGIEYCQHRSRSF 180 >SB_7076| Best HMM Match : IncA (HMM E-Value=0.74) Length = 282 Score = 27.9 bits (59), Expect = 9.7 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = -3 Query: 230 LELIFDRLSLIHQWCNLVSRPKCHNMWSP*PFLLCL 123 LE+ ++ I+ +C++V R KC + P L CL Sbjct: 8 LEVTLPKIEAIYVFCDIVDRSKCLALDEPSNVLACL 43 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,119,230 Number of Sequences: 59808 Number of extensions: 443442 Number of successful extensions: 1204 Number of sequences better than 10.0: 43 Number of HSP's better than 10.0 without gapping: 1080 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1192 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2119930593 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -