BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30611 (778 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY825832-1|AAV70395.1| 168|Anopheles gambiae heat shock protein... 32 0.023 AY825831-1|AAV70394.1| 168|Anopheles gambiae heat shock protein... 32 0.023 AY825830-1|AAV70393.1| 169|Anopheles gambiae heat shock protein... 32 0.023 AY825829-1|AAV70392.1| 169|Anopheles gambiae heat shock protein... 32 0.023 AY825828-1|AAV70391.1| 172|Anopheles gambiae heat shock protein... 32 0.023 AY825827-1|AAV70390.1| 172|Anopheles gambiae heat shock protein... 32 0.023 AY825826-1|AAV70389.1| 169|Anopheles gambiae heat shock protein... 32 0.023 AY825825-1|AAV70388.1| 169|Anopheles gambiae heat shock protein... 32 0.023 AY825820-1|AAV70383.1| 168|Anopheles gambiae heat shock protein... 32 0.023 AY825819-1|AAV70382.1| 168|Anopheles gambiae heat shock protein... 32 0.023 AY825818-1|AAV70381.1| 168|Anopheles gambiae heat shock protein... 32 0.023 AY825817-1|AAV70380.1| 168|Anopheles gambiae heat shock protein... 32 0.023 AY825814-1|AAV70377.1| 169|Anopheles gambiae heat shock protein... 32 0.023 AY825813-1|AAV70376.1| 169|Anopheles gambiae heat shock protein... 32 0.023 AY825812-1|AAV70375.1| 168|Anopheles gambiae heat shock protein... 32 0.023 AY825811-1|AAV70374.1| 168|Anopheles gambiae heat shock protein... 32 0.023 AY825810-1|AAV70373.1| 169|Anopheles gambiae heat shock protein... 32 0.023 AY825809-1|AAV70372.1| 169|Anopheles gambiae heat shock protein... 32 0.023 AY825808-1|AAV70371.1| 171|Anopheles gambiae heat shock protein... 32 0.023 AY825807-1|AAV70370.1| 171|Anopheles gambiae heat shock protein... 32 0.023 AY825806-1|AAV70369.1| 168|Anopheles gambiae heat shock protein... 32 0.023 AY825805-1|AAV70368.1| 168|Anopheles gambiae heat shock protein... 32 0.023 AY825804-1|AAV70367.1| 168|Anopheles gambiae heat shock protein... 32 0.023 AY825803-1|AAV70366.1| 168|Anopheles gambiae heat shock protein... 32 0.023 AY825802-1|AAV70365.1| 168|Anopheles gambiae heat shock protein... 32 0.023 AY825801-1|AAV70364.1| 168|Anopheles gambiae heat shock protein... 32 0.023 AY825800-1|AAV70363.1| 171|Anopheles gambiae heat shock protein... 32 0.023 AY825799-1|AAV70362.1| 171|Anopheles gambiae heat shock protein... 32 0.023 AY825798-1|AAV70361.1| 168|Anopheles gambiae heat shock protein... 32 0.023 AY825797-1|AAV70360.1| 168|Anopheles gambiae heat shock protein... 32 0.023 AY825796-1|AAV70359.1| 174|Anopheles gambiae heat shock protein... 32 0.023 AY825795-1|AAV70358.1| 174|Anopheles gambiae heat shock protein... 32 0.023 AY825794-1|AAV70357.1| 169|Anopheles gambiae heat shock protein... 32 0.023 AY825793-1|AAV70356.1| 169|Anopheles gambiae heat shock protein... 32 0.023 AY825790-1|AAV70353.1| 168|Anopheles gambiae heat shock protein... 32 0.023 AY825789-1|AAV70352.1| 168|Anopheles gambiae heat shock protein... 32 0.023 AY825788-1|AAV70351.1| 168|Anopheles gambiae heat shock protein... 32 0.023 AY825787-1|AAV70350.1| 168|Anopheles gambiae heat shock protein... 32 0.023 AY825786-1|AAV70349.1| 168|Anopheles gambiae heat shock protein... 32 0.023 AY825785-1|AAV70348.1| 168|Anopheles gambiae heat shock protein... 32 0.023 AY825784-1|AAV70347.1| 168|Anopheles gambiae heat shock protein... 32 0.023 AY825783-1|AAV70346.1| 168|Anopheles gambiae heat shock protein... 32 0.023 AY825782-1|AAV70345.1| 168|Anopheles gambiae heat shock protein... 32 0.023 AY825781-1|AAV70344.1| 168|Anopheles gambiae heat shock protein... 32 0.023 AJ439353-6|CAD27928.1| 695|Anopheles gambiae putative G-protein... 27 0.49 U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. 25 2.0 U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. 25 2.0 AY146743-1|AAO12103.1| 192|Anopheles gambiae odorant-binding pr... 25 2.6 DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. 23 8.0 >AY825832-1|AAV70395.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 31.9 bits (69), Expect = 0.023 Identities = 12/25 (48%), Positives = 20/25 (80%) Frame = +1 Query: 265 KFKQISQAYEVLSNPDKRRIYDQGG 339 +F +I Q+YE+LS+ ++RR +DQ G Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825831-1|AAV70394.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 31.9 bits (69), Expect = 0.023 Identities = 12/25 (48%), Positives = 20/25 (80%) Frame = +1 Query: 265 KFKQISQAYEVLSNPDKRRIYDQGG 339 +F +I Q+YE+LS+ ++RR +DQ G Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825830-1|AAV70393.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 31.9 bits (69), Expect = 0.023 Identities = 12/25 (48%), Positives = 20/25 (80%) Frame = +1 Query: 265 KFKQISQAYEVLSNPDKRRIYDQGG 339 +F +I Q+YE+LS+ ++RR +DQ G Sbjct: 3 RFVEIKQSYELLSDSERRRAFDQYG 27 >AY825829-1|AAV70392.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 31.9 bits (69), Expect = 0.023 Identities = 12/25 (48%), Positives = 20/25 (80%) Frame = +1 Query: 265 KFKQISQAYEVLSNPDKRRIYDQGG 339 +F +I Q+YE+LS+ ++RR +DQ G Sbjct: 3 RFVEIKQSYELLSDSERRRAFDQYG 27 >AY825828-1|AAV70391.1| 172|Anopheles gambiae heat shock protein DnaJ protein. Length = 172 Score = 31.9 bits (69), Expect = 0.023 Identities = 12/25 (48%), Positives = 20/25 (80%) Frame = +1 Query: 265 KFKQISQAYEVLSNPDKRRIYDQGG 339 +F +I Q+YE+LS+ ++RR +DQ G Sbjct: 3 RFVEIKQSYELLSDSERRRAFDQYG 27 >AY825827-1|AAV70390.1| 172|Anopheles gambiae heat shock protein DnaJ protein. Length = 172 Score = 31.9 bits (69), Expect = 0.023 Identities = 12/25 (48%), Positives = 20/25 (80%) Frame = +1 Query: 265 KFKQISQAYEVLSNPDKRRIYDQGG 339 +F +I Q+YE+LS+ ++RR +DQ G Sbjct: 3 RFVEIKQSYELLSDSERRRAFDQYG 27 >AY825826-1|AAV70389.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 31.9 bits (69), Expect = 0.023 Identities = 12/25 (48%), Positives = 20/25 (80%) Frame = +1 Query: 265 KFKQISQAYEVLSNPDKRRIYDQGG 339 +F +I Q+YE+LS+ ++RR +DQ G Sbjct: 3 RFVEIKQSYELLSDSERRRAFDQYG 27 >AY825825-1|AAV70388.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 31.9 bits (69), Expect = 0.023 Identities = 12/25 (48%), Positives = 20/25 (80%) Frame = +1 Query: 265 KFKQISQAYEVLSNPDKRRIYDQGG 339 +F +I Q+YE+LS+ ++RR +DQ G Sbjct: 3 RFVEIKQSYELLSDSERRRAFDQYG 27 >AY825820-1|AAV70383.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 31.9 bits (69), Expect = 0.023 Identities = 12/25 (48%), Positives = 20/25 (80%) Frame = +1 Query: 265 KFKQISQAYEVLSNPDKRRIYDQGG 339 +F +I Q+YE+LS+ ++RR +DQ G Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825819-1|AAV70382.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 31.9 bits (69), Expect = 0.023 Identities = 12/25 (48%), Positives = 20/25 (80%) Frame = +1 Query: 265 KFKQISQAYEVLSNPDKRRIYDQGG 339 +F +I Q+YE+LS+ ++RR +DQ G Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825818-1|AAV70381.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 31.9 bits (69), Expect = 0.023 Identities = 12/25 (48%), Positives = 20/25 (80%) Frame = +1 Query: 265 KFKQISQAYEVLSNPDKRRIYDQGG 339 +F +I Q+YE+LS+ ++RR +DQ G Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825817-1|AAV70380.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 31.9 bits (69), Expect = 0.023 Identities = 12/25 (48%), Positives = 20/25 (80%) Frame = +1 Query: 265 KFKQISQAYEVLSNPDKRRIYDQGG 339 +F +I Q+YE+LS+ ++RR +DQ G Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825814-1|AAV70377.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 31.9 bits (69), Expect = 0.023 Identities = 12/25 (48%), Positives = 20/25 (80%) Frame = +1 Query: 265 KFKQISQAYEVLSNPDKRRIYDQGG 339 +F +I Q+YE+LS+ ++RR +DQ G Sbjct: 3 RFVEIKQSYELLSDSERRRAFDQYG 27 >AY825813-1|AAV70376.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 31.9 bits (69), Expect = 0.023 Identities = 12/25 (48%), Positives = 20/25 (80%) Frame = +1 Query: 265 KFKQISQAYEVLSNPDKRRIYDQGG 339 +F +I Q+YE+LS+ ++RR +DQ G Sbjct: 3 RFVEIKQSYELLSDSERRRAFDQYG 27 >AY825812-1|AAV70375.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 31.9 bits (69), Expect = 0.023 Identities = 12/25 (48%), Positives = 20/25 (80%) Frame = +1 Query: 265 KFKQISQAYEVLSNPDKRRIYDQGG 339 +F +I Q+YE+LS+ ++RR +DQ G Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825811-1|AAV70374.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 31.9 bits (69), Expect = 0.023 Identities = 12/25 (48%), Positives = 20/25 (80%) Frame = +1 Query: 265 KFKQISQAYEVLSNPDKRRIYDQGG 339 +F +I Q+YE+LS+ ++RR +DQ G Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825810-1|AAV70373.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 31.9 bits (69), Expect = 0.023 Identities = 12/25 (48%), Positives = 20/25 (80%) Frame = +1 Query: 265 KFKQISQAYEVLSNPDKRRIYDQGG 339 +F +I Q+YE+LS+ ++RR +DQ G Sbjct: 3 RFVEIKQSYELLSDSERRRAFDQYG 27 >AY825809-1|AAV70372.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 31.9 bits (69), Expect = 0.023 Identities = 12/25 (48%), Positives = 20/25 (80%) Frame = +1 Query: 265 KFKQISQAYEVLSNPDKRRIYDQGG 339 +F +I Q+YE+LS+ ++RR +DQ G Sbjct: 3 RFVEIKQSYELLSDSERRRAFDQYG 27 >AY825808-1|AAV70371.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 31.9 bits (69), Expect = 0.023 Identities = 12/25 (48%), Positives = 20/25 (80%) Frame = +1 Query: 265 KFKQISQAYEVLSNPDKRRIYDQGG 339 +F +I Q+YE+LS+ ++RR +DQ G Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825807-1|AAV70370.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 31.9 bits (69), Expect = 0.023 Identities = 12/25 (48%), Positives = 20/25 (80%) Frame = +1 Query: 265 KFKQISQAYEVLSNPDKRRIYDQGG 339 +F +I Q+YE+LS+ ++RR +DQ G Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825806-1|AAV70369.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 31.9 bits (69), Expect = 0.023 Identities = 12/25 (48%), Positives = 20/25 (80%) Frame = +1 Query: 265 KFKQISQAYEVLSNPDKRRIYDQGG 339 +F +I Q+YE+LS+ ++RR +DQ G Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825805-1|AAV70368.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 31.9 bits (69), Expect = 0.023 Identities = 12/25 (48%), Positives = 20/25 (80%) Frame = +1 Query: 265 KFKQISQAYEVLSNPDKRRIYDQGG 339 +F +I Q+YE+LS+ ++RR +DQ G Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825804-1|AAV70367.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 31.9 bits (69), Expect = 0.023 Identities = 12/25 (48%), Positives = 20/25 (80%) Frame = +1 Query: 265 KFKQISQAYEVLSNPDKRRIYDQGG 339 +F +I Q+YE+LS+ ++RR +DQ G Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825803-1|AAV70366.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 31.9 bits (69), Expect = 0.023 Identities = 12/25 (48%), Positives = 20/25 (80%) Frame = +1 Query: 265 KFKQISQAYEVLSNPDKRRIYDQGG 339 +F +I Q+YE+LS+ ++RR +DQ G Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825802-1|AAV70365.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 31.9 bits (69), Expect = 0.023 Identities = 12/25 (48%), Positives = 20/25 (80%) Frame = +1 Query: 265 KFKQISQAYEVLSNPDKRRIYDQGG 339 +F +I Q+YE+LS+ ++RR +DQ G Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825801-1|AAV70364.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 31.9 bits (69), Expect = 0.023 Identities = 12/25 (48%), Positives = 20/25 (80%) Frame = +1 Query: 265 KFKQISQAYEVLSNPDKRRIYDQGG 339 +F +I Q+YE+LS+ ++RR +DQ G Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825800-1|AAV70363.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 31.9 bits (69), Expect = 0.023 Identities = 12/25 (48%), Positives = 20/25 (80%) Frame = +1 Query: 265 KFKQISQAYEVLSNPDKRRIYDQGG 339 +F +I Q+YE+LS+ ++RR +DQ G Sbjct: 3 RFVEIKQSYELLSDSERRRAFDQYG 27 >AY825799-1|AAV70362.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 31.9 bits (69), Expect = 0.023 Identities = 12/25 (48%), Positives = 20/25 (80%) Frame = +1 Query: 265 KFKQISQAYEVLSNPDKRRIYDQGG 339 +F +I Q+YE+LS+ ++RR +DQ G Sbjct: 3 RFVEIKQSYELLSDSERRRAFDQYG 27 >AY825798-1|AAV70361.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 31.9 bits (69), Expect = 0.023 Identities = 12/25 (48%), Positives = 20/25 (80%) Frame = +1 Query: 265 KFKQISQAYEVLSNPDKRRIYDQGG 339 +F +I Q+YE+LS+ ++RR +DQ G Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825797-1|AAV70360.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 31.9 bits (69), Expect = 0.023 Identities = 12/25 (48%), Positives = 20/25 (80%) Frame = +1 Query: 265 KFKQISQAYEVLSNPDKRRIYDQGG 339 +F +I Q+YE+LS+ ++RR +DQ G Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825796-1|AAV70359.1| 174|Anopheles gambiae heat shock protein DnaJ protein. Length = 174 Score = 31.9 bits (69), Expect = 0.023 Identities = 12/25 (48%), Positives = 20/25 (80%) Frame = +1 Query: 265 KFKQISQAYEVLSNPDKRRIYDQGG 339 +F +I Q+YE+LS+ ++RR +DQ G Sbjct: 5 RFVEIKQSYELLSDSERRRAFDQYG 29 >AY825795-1|AAV70358.1| 174|Anopheles gambiae heat shock protein DnaJ protein. Length = 174 Score = 31.9 bits (69), Expect = 0.023 Identities = 12/25 (48%), Positives = 20/25 (80%) Frame = +1 Query: 265 KFKQISQAYEVLSNPDKRRIYDQGG 339 +F +I Q+YE+LS+ ++RR +DQ G Sbjct: 5 RFVEIKQSYELLSDSERRRAFDQYG 29 >AY825794-1|AAV70357.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 31.9 bits (69), Expect = 0.023 Identities = 12/25 (48%), Positives = 20/25 (80%) Frame = +1 Query: 265 KFKQISQAYEVLSNPDKRRIYDQGG 339 +F +I Q+YE+LS+ ++RR +DQ G Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825793-1|AAV70356.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 31.9 bits (69), Expect = 0.023 Identities = 12/25 (48%), Positives = 20/25 (80%) Frame = +1 Query: 265 KFKQISQAYEVLSNPDKRRIYDQGG 339 +F +I Q+YE+LS+ ++RR +DQ G Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825790-1|AAV70353.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 31.9 bits (69), Expect = 0.023 Identities = 12/25 (48%), Positives = 20/25 (80%) Frame = +1 Query: 265 KFKQISQAYEVLSNPDKRRIYDQGG 339 +F +I Q+YE+LS+ ++RR +DQ G Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825789-1|AAV70352.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 31.9 bits (69), Expect = 0.023 Identities = 12/25 (48%), Positives = 20/25 (80%) Frame = +1 Query: 265 KFKQISQAYEVLSNPDKRRIYDQGG 339 +F +I Q+YE+LS+ ++RR +DQ G Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825788-1|AAV70351.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 31.9 bits (69), Expect = 0.023 Identities = 12/25 (48%), Positives = 20/25 (80%) Frame = +1 Query: 265 KFKQISQAYEVLSNPDKRRIYDQGG 339 +F +I Q+YE+LS+ ++RR +DQ G Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825787-1|AAV70350.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 31.9 bits (69), Expect = 0.023 Identities = 12/25 (48%), Positives = 20/25 (80%) Frame = +1 Query: 265 KFKQISQAYEVLSNPDKRRIYDQGG 339 +F +I Q+YE+LS+ ++RR +DQ G Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825786-1|AAV70349.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 31.9 bits (69), Expect = 0.023 Identities = 12/25 (48%), Positives = 20/25 (80%) Frame = +1 Query: 265 KFKQISQAYEVLSNPDKRRIYDQGG 339 +F +I Q+YE+LS+ ++RR +DQ G Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825785-1|AAV70348.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 31.9 bits (69), Expect = 0.023 Identities = 12/25 (48%), Positives = 20/25 (80%) Frame = +1 Query: 265 KFKQISQAYEVLSNPDKRRIYDQGG 339 +F +I Q+YE+LS+ ++RR +DQ G Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825784-1|AAV70347.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 31.9 bits (69), Expect = 0.023 Identities = 12/25 (48%), Positives = 20/25 (80%) Frame = +1 Query: 265 KFKQISQAYEVLSNPDKRRIYDQGG 339 +F +I Q+YE+LS+ ++RR +DQ G Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825783-1|AAV70346.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 31.9 bits (69), Expect = 0.023 Identities = 12/25 (48%), Positives = 20/25 (80%) Frame = +1 Query: 265 KFKQISQAYEVLSNPDKRRIYDQGG 339 +F +I Q+YE+LS+ ++RR +DQ G Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825782-1|AAV70345.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 31.9 bits (69), Expect = 0.023 Identities = 12/25 (48%), Positives = 20/25 (80%) Frame = +1 Query: 265 KFKQISQAYEVLSNPDKRRIYDQGG 339 +F +I Q+YE+LS+ ++RR +DQ G Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825781-1|AAV70344.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 31.9 bits (69), Expect = 0.023 Identities = 12/25 (48%), Positives = 20/25 (80%) Frame = +1 Query: 265 KFKQISQAYEVLSNPDKRRIYDQGG 339 +F +I Q+YE+LS+ ++RR +DQ G Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AJ439353-6|CAD27928.1| 695|Anopheles gambiae putative G-protein coupled receptor protein. Length = 695 Score = 27.5 bits (58), Expect = 0.49 Identities = 17/46 (36%), Positives = 22/46 (47%) Frame = -2 Query: 687 AFAAYCLNLLYHTRA*LLKFVLAYQSHGTLDKFELHPFYHHVPHIS 550 AF CLNLL A L F+L Q+ + + EL H H+S Sbjct: 220 AFYPICLNLLLALIASNLSFILGVQATRNVIRCELIALLLHYLHLS 265 >U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 25.4 bits (53), Expect = 2.0 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = -1 Query: 376 HHHYHPLPLMLVHHLDHK 323 HHH HP L HH H+ Sbjct: 93 HHHQHPHHHQLPHHPHHQ 110 >U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 25.4 bits (53), Expect = 2.0 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = -1 Query: 376 HHHYHPLPLMLVHHLDHK 323 HHH HP L HH H+ Sbjct: 93 HHHQHPHHHQLPHHPHHQ 110 >AY146743-1|AAO12103.1| 192|Anopheles gambiae odorant-binding protein AgamOBP11 protein. Length = 192 Score = 25.0 bits (52), Expect = 2.6 Identities = 9/32 (28%), Positives = 17/32 (53%) Frame = -1 Query: 451 VPCGVYLH*IHLQRTCQRDPLVKKIHHHYHPL 356 +PC + Q C ++P+ K + +H+H L Sbjct: 143 LPCPDRCTAAYKQELCFQEPIAKYLDYHFHDL 174 >DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. Length = 889 Score = 23.4 bits (48), Expect = 8.0 Identities = 13/50 (26%), Positives = 22/50 (44%) Frame = -1 Query: 442 GVYLH*IHLQRTCQRDPLVKKIHHHYHPLPLMLVHHLDHKFAFCQDSRAP 293 G+ LH Q+ Q+ + HHH+H P K + + S++P Sbjct: 141 GIVLHHQAHQQQQQQQQQLHHHHHHHHNAPAGGESSTSEKDSSRESSKSP 190 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 762,539 Number of Sequences: 2352 Number of extensions: 15701 Number of successful extensions: 86 Number of sequences better than 10.0: 49 Number of HSP's better than 10.0 without gapping: 79 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 85 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 81081585 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -