BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30610 (432 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-14|CAD27765.1| 471|Anopheles gambiae putative acetyltr... 24 2.0 CR954257-11|CAJ14162.1| 415|Anopheles gambiae predicted protein... 22 8.1 >AJ439060-14|CAD27765.1| 471|Anopheles gambiae putative acetyltransferase protein. Length = 471 Score = 24.2 bits (50), Expect = 2.0 Identities = 12/39 (30%), Positives = 24/39 (61%), Gaps = 1/39 (2%) Frame = +1 Query: 106 IAEFLLKNNR*KYILLQTYLSSKY*FHCLRL-CYFYYCF 219 +++F+L + +Y++ Q Y SS+ + R CY+YY + Sbjct: 169 VSKFILASEPHRYVV-QRYESSEEELYARRQNCYYYYYY 206 >CR954257-11|CAJ14162.1| 415|Anopheles gambiae predicted protein protein. Length = 415 Score = 22.2 bits (45), Expect = 8.1 Identities = 8/25 (32%), Positives = 17/25 (68%) Frame = -3 Query: 298 KKIFDKFPIALKFYGIRSSICHELY 224 K ++ I+ + +GI+ +ICH+L+ Sbjct: 366 KHEYEVHRISNENFGIKCTICHKLF 390 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 361,635 Number of Sequences: 2352 Number of extensions: 5783 Number of successful extensions: 10 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 35717724 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -