BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30607 (681 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g36870.1 68417.m05228 BEL1-like homeobox 2 protein (BLH2) 28 6.6 At5g09410.1 68418.m01090 calmodulin-binding protein similar to a... 27 8.7 >At4g36870.1 68417.m05228 BEL1-like homeobox 2 protein (BLH2) Length = 638 Score = 27.9 bits (59), Expect = 6.6 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +2 Query: 2 ISEWFPSPNHHEHVHES 52 IS W SP+HH H H S Sbjct: 204 ISTWQSSPDHHHHHHNS 220 >At5g09410.1 68418.m01090 calmodulin-binding protein similar to anther ethylene-upregulated calmodulin-binding protein ER1 GI:11612392 from [Nicotiana tabacum] Length = 1007 Score = 27.5 bits (58), Expect = 8.7 Identities = 14/49 (28%), Positives = 25/49 (51%), Gaps = 1/49 (2%) Frame = +2 Query: 29 HHEHVHESHGWDRSDNNEASSKKVETIKEAPKHVAPKAPEK-STWQFPK 172 H + VHE H ++ + K+ +KE +++ P ++ ST Q PK Sbjct: 531 HRDFVHEHHIFEDVGDKRRQISKIMLLKEEKEYLLPGTYQRDSTKQEPK 579 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,311,863 Number of Sequences: 28952 Number of extensions: 248681 Number of successful extensions: 701 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 670 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 697 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1438152744 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -