BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30605 (750 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC644.05c |||deoxyuridine 5'-triphosphate nucleotidohydrolase ... 74 2e-14 SPCC1672.06c |asp1|vip1|inositol hexakisphosphate kinase/inosito... 26 5.0 >SPAC644.05c |||deoxyuridine 5'-triphosphate nucleotidohydrolase |Schizosaccharomyces pombe|chr 1|||Manual Length = 140 Score = 74.1 bits (174), Expect = 2e-14 Identities = 35/52 (67%), Positives = 40/52 (76%) Frame = +2 Query: 509 APRSGLALKNFIDVGAGVIDEDYRGNVGVVLFNHSDTDFSVKKGDRIGTAYL 664 APRSGLA K+ ID GAGVID DYRG+V V+LFN+SD DF +K GDRI L Sbjct: 60 APRSGLASKHSIDTGAGVIDADYRGHVRVLLFNYSDVDFPIKVGDRIAQLIL 111 Score = 58.4 bits (135), Expect = 1e-09 Identities = 29/53 (54%), Positives = 35/53 (66%) Frame = +3 Query: 351 RLSENAFQPVRGSEKAAGIDLMSAYDYTVPARGKELVKTDLQIELPPGCYGRV 509 +LSE A P +GS +AG DL +A + VP RGK LV TDL I +P G YGRV Sbjct: 7 KLSEKATIPTKGSANSAGYDLYAAAECIVPRRGKVLVDTDLAIAVPEGTYGRV 59 >SPCC1672.06c |asp1|vip1|inositol hexakisphosphate kinase/inositol pyrophosphate synthase |Schizosaccharomyces pombe|chr 3|||Manual Length = 920 Score = 26.2 bits (55), Expect = 5.0 Identities = 20/68 (29%), Positives = 35/68 (51%) Frame = +3 Query: 423 YDYTVPARGKELVKTDLQIELPPGCYGRVHLDLA*L*RISLMLVPVLLMRTIEVMLELFF 602 ++ T P+ KE ++I L PGCY + LD+ + + + P R++ L+L Sbjct: 843 FERTNPSGNKEF---SVRITLSPGCYAQCPLDMNLDAKHCISVSP---RRSLTRHLDLQQ 896 Query: 603 LITRTQTL 626 IT+T+ L Sbjct: 897 FITKTEDL 904 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,752,739 Number of Sequences: 5004 Number of extensions: 51332 Number of successful extensions: 117 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 114 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 117 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 357280532 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -