BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30605 (750 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_05_0620 - 26196597-26196841,26196929-26197020,26197118-26197296 87 2e-17 04_04_0518 - 25858336-25859537,25859919-25860749,25861640-25861727 29 5.2 >03_05_0620 - 26196597-26196841,26196929-26197020,26197118-26197296 Length = 171 Score = 86.6 bits (205), Expect = 2e-17 Identities = 40/47 (85%), Positives = 43/47 (91%) Frame = +2 Query: 509 APRSGLALKNFIDVGAGVIDEDYRGNVGVVLFNHSDTDFSVKKGDRI 649 APRSGLALK+ IDVGAGVID DYRG VGV+LFNHSDTDF+VK GDRI Sbjct: 91 APRSGLALKHSIDVGAGVIDADYRGPVGVILFNHSDTDFAVKPGDRI 137 Score = 73.7 bits (173), Expect = 1e-13 Identities = 36/62 (58%), Positives = 42/62 (67%) Frame = +3 Query: 324 KIQPILKFTRLSENAFQPVRGSEKAAGIDLMSAYDYTVPARGKELVKTDLQIELPPGCYG 503 K+ P+LK +LSENA P RGS AAG DL SA + VPARGK +V TDL I +P G Y Sbjct: 29 KVAPLLKVKKLSENAVLPSRGSALAAGYDLSSAAEVVVPARGKAMVPTDLSIAIPEGTYA 88 Query: 504 RV 509 RV Sbjct: 89 RV 90 >04_04_0518 - 25858336-25859537,25859919-25860749,25861640-25861727 Length = 706 Score = 28.7 bits (61), Expect = 5.2 Identities = 11/29 (37%), Positives = 20/29 (68%) Frame = +1 Query: 655 SLFVRRSTILVLQEVAKFVCNSKGVMGGI 741 ++ + RST+ VL ++ F N+ G+MGG+ Sbjct: 91 NISLSRSTLRVLNGISTFCYNASGLMGGV 119 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,360,776 Number of Sequences: 37544 Number of extensions: 293103 Number of successful extensions: 455 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 451 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 455 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1992480932 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -