BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30605 (750 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g46940.1 68416.m05095 deoxyuridine 5'-triphosphate nucleotido... 81 8e-16 >At3g46940.1 68416.m05095 deoxyuridine 5'-triphosphate nucleotidohydrolase family contains Pfam profile: PF00692 deoxyuridine 5'-triphosphate nucleotidohydrolase Length = 166 Score = 81.0 bits (191), Expect = 8e-16 Identities = 38/47 (80%), Positives = 40/47 (85%) Frame = +2 Query: 509 APRSGLALKNFIDVGAGVIDEDYRGNVGVVLFNHSDTDFSVKKGDRI 649 APRSGLA K+ IDVGAGVID DYRG VGV+LFNHSD DF VK GDRI Sbjct: 86 APRSGLAWKHSIDVGAGVIDADYRGPVGVILFNHSDADFEVKFGDRI 132 Score = 66.1 bits (154), Expect = 2e-11 Identities = 32/59 (54%), Positives = 37/59 (62%) Frame = +3 Query: 333 PILKFTRLSENAFQPVRGSEKAAGIDLMSAYDYTVPARGKELVKTDLQIELPPGCYGRV 509 P K +LSE A P RGS +AG DL SA D VPARGK L+ TDL I +P G Y R+ Sbjct: 27 PFFKVKKLSEKAVIPTRGSPLSAGYDLSSAVDSKVPARGKALIPTDLSIAVPEGTYARI 85 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,878,334 Number of Sequences: 28952 Number of extensions: 255499 Number of successful extensions: 463 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 458 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 463 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1663169840 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -