BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30602 (805 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE014296-3572|AAS65091.1| 171|Drosophila melanogaster CG33290-P... 57 3e-08 AE014296-3612|AAF51775.1| 190|Drosophila melanogaster CG14567-P... 56 4e-08 >AE014296-3572|AAS65091.1| 171|Drosophila melanogaster CG33290-PA protein. Length = 171 Score = 56.8 bits (131), Expect = 3e-08 Identities = 22/48 (45%), Positives = 36/48 (75%) Frame = +3 Query: 225 NNAKTSDRSEGDLELIDRLSKLPVDKQPFWFINWQALEAHRKNPQTHV 368 +N++ + GD + ++RL +LPVD+QPFW +N+QA+EA R NP+ +V Sbjct: 112 DNSRLPIDARGDRDWVNRLKQLPVDQQPFWLVNYQAIEAMRNNPRPNV 159 >AE014296-3612|AAF51775.1| 190|Drosophila melanogaster CG14567-PA protein. Length = 190 Score = 56.4 bits (130), Expect = 4e-08 Identities = 22/40 (55%), Positives = 33/40 (82%) Frame = +3 Query: 249 SEGDLELIDRLSKLPVDKQPFWFINWQALEAHRKNPQTHV 368 + GD E ++ LS+LPV++QPFWFIN+QA+EAHR + + +V Sbjct: 139 AHGDREWVNHLSQLPVEQQPFWFINYQAIEAHRNSSRPNV 178 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 35,580,753 Number of Sequences: 53049 Number of extensions: 752389 Number of successful extensions: 1770 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1658 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1770 length of database: 24,988,368 effective HSP length: 84 effective length of database: 20,532,252 effective search space used: 3757402116 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -