BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30599 (788 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g57720.1 68418.m07215 transcriptional factor B3 family protei... 33 0.16 At3g16470.1 68416.m02101 jacalin lectin family protein contains ... 30 1.5 At3g20430.1 68416.m02587 expressed protein 29 2.7 At3g50380.1 68416.m05511 expressed protein 29 3.5 At2g32850.2 68415.m04025 protein kinase family protein contains ... 29 3.5 At5g42900.2 68418.m05229 expressed protein similar to unknown pr... 29 4.6 At1g73450.1 68414.m08503 protein kinase, putative similar to nuc... 29 4.6 At1g13190.1 68414.m01529 RNA recognition motif (RRM)-containing ... 29 4.6 At5g17930.1 68418.m02102 MA3 domain-containing protein low simil... 28 8.1 At1g47790.1 68414.m05317 F-box family protein contains Pfam:PF00... 28 8.1 At1g35080.1 68414.m04347 hypothetical protein 28 8.1 >At5g57720.1 68418.m07215 transcriptional factor B3 family protein contains Pfam profile PF02362: B3 DNA binding domain Length = 300 Score = 33.5 bits (73), Expect = 0.16 Identities = 21/106 (19%), Positives = 45/106 (42%) Frame = +1 Query: 160 QSYGQRDNETYRDGHRYYRRRNETDMNTDHSKRTMIAQSIKVRKTEDYGTAVT*TLNRSQ 339 Q ++ET DG + +TD N S + + +DY TA+ +N++ Sbjct: 117 QEISDDEDETNGDGDPHMEEEGDTDENMIVSLSLGSSDEVGDDDDDDYDTAICDEVNKAS 176 Query: 340 KASQTAIITTRINKNKLLAASTRKLLRSQTSQLKLIQISIQRKLLI 477 +S+ +T + + L + + + L + + S R++L+ Sbjct: 177 GSSKKGRVTRKHRDDSLASITPQIFLADPNNPFFISTSSCSRRILV 222 >At3g16470.1 68416.m02101 jacalin lectin family protein contains Pfam profile: PF01419 jacalin-like lectin domain; similar to myrosinase-binding protein homolog [Arabidopsis thaliana] GI:2997767 Length = 451 Score = 30.3 bits (65), Expect = 1.5 Identities = 14/59 (23%), Positives = 30/59 (50%) Frame = +1 Query: 211 YRRRNETDMNTDHSKRTMIAQSIKVRKTEDYGTAVT*TLNRSQKASQTAIITTRINKNK 387 Y + ++ + +DH K+T++ V ++Y TAV+ ++ AI++ + NK Sbjct: 347 YEKASKPVLGSDHGKKTLLGAEEFVLGPDEYVTAVSGYYDKIFSVDAPAIVSLKFKTNK 405 >At3g20430.1 68416.m02587 expressed protein Length = 265 Score = 29.5 bits (63), Expect = 2.7 Identities = 18/71 (25%), Positives = 34/71 (47%) Frame = +2 Query: 515 ESQGDRDHLKESVTHMRDHDPVGQIDHGKNAVNQFVNTSPRSGDDFKSVKDMRCLPGPLN 694 ES D + ++ ++ D + V ++ G+ V+ +++ R DD VKD + G N Sbjct: 5 ESLLDAINEEDGFENLEDVEMV-DVEEGEIVVDHDLDSGERQNDDGDGVKDKEAILGEKN 63 Query: 695 GSEDGFRGKTK 727 G + + K K Sbjct: 64 GLQQTNKNKRK 74 >At3g50380.1 68416.m05511 expressed protein Length = 3071 Score = 29.1 bits (62), Expect = 3.5 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = +2 Query: 497 SKSGYSESQGDRDHLKESVTHMRDHDPVGQIDHGKN 604 +K S S+G++ H++E V + D DP QI N Sbjct: 551 TKDPSSSSEGNKKHMREDVKTILDMDPAQQISKTVN 586 >At2g32850.2 68415.m04025 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 670 Score = 29.1 bits (62), Expect = 3.5 Identities = 16/39 (41%), Positives = 18/39 (46%) Frame = +3 Query: 282 GPQNRRLWNSGDVNIKPVTESITDGYNNNTYKQKQTTRS 398 G + W KPV ES + G NNNT Q TRS Sbjct: 563 GSSDTNSWQPFSDEAKPVMESASKG-NNNTINQSVRTRS 600 >At5g42900.2 68418.m05229 expressed protein similar to unknown protein (pir||T05226) Length = 245 Score = 28.7 bits (61), Expect = 4.6 Identities = 17/50 (34%), Positives = 24/50 (48%), Gaps = 2/50 (4%) Frame = +2 Query: 518 SQGDRDHLKESVTHMRDHD--PVGQIDHGKNAVNQFVNTSPRSGDDFKSV 661 S G LK+ +H RDHD VG+ +N VN+ + S K+V Sbjct: 168 SSGSASSLKQLSSHSRDHDQISVGEEVSDQNFVNEGIKGENGSSKKMKTV 217 >At1g73450.1 68414.m08503 protein kinase, putative similar to nuclear serine/threonine protein kinase GI:3582644 from [Rattus norvegicus] Length = 1152 Score = 28.7 bits (61), Expect = 4.6 Identities = 14/57 (24%), Positives = 32/57 (56%), Gaps = 1/57 (1%) Frame = +1 Query: 133 NRETSTDVD-QSYGQRDNETYRDGHRYYRRRNETDMNTDHSKRTMIAQSIKVRKTED 300 +R+ + D D QSY + +E+Y G RY + ++ +++++ +R +++ K D Sbjct: 472 DRDANKDEDDQSYAE--DESYLSGERYLQSKDAEPISSENDRRLTVSEIYPACKKND 526 >At1g13190.1 68414.m01529 RNA recognition motif (RRM)-containing protein Length = 573 Score = 28.7 bits (61), Expect = 4.6 Identities = 15/64 (23%), Positives = 33/64 (51%), Gaps = 3/64 (4%) Frame = +1 Query: 118 TRNIENRETSTDVDQSYGQRDNETYR---DGHRYYRRRNETDMNTDHSKRTMIAQSIKVR 288 +R+ E T D ++ G R ++++R D HR Y+++ + D + ++ + + R Sbjct: 492 SRDKERATTERDWSENSGDRRHKSHREEKDSHREYKQQRDRDSDEFDRGQSSLKSRSRSR 551 Query: 289 KTED 300 +ED Sbjct: 552 MSED 555 >At5g17930.1 68418.m02102 MA3 domain-containing protein low similarity to SP|Q9P6R9 Cell cycle control protein cwf22 {Schizosaccharomyces pombe}; contains Pfam profile PF02847: MA3 domain Length = 707 Score = 27.9 bits (59), Expect = 8.1 Identities = 15/38 (39%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = +2 Query: 500 KSGYSESQGDRDHLKESVT-HMRDHDPVGQIDHGKNAV 610 KSG D + +SVT HM P G DHGK+ + Sbjct: 24 KSGDVIKSEDFRQISDSVTEHMESSSPSGNKDHGKSFI 61 >At1g47790.1 68414.m05317 F-box family protein contains Pfam:PF00646 F-box domain Length = 389 Score = 27.9 bits (59), Expect = 8.1 Identities = 18/59 (30%), Positives = 27/59 (45%), Gaps = 2/59 (3%) Frame = -2 Query: 691 QRPWKTPHVLH*FKVIAGPWG-CVNKLVYSILSVVYLSN-RVMVTHVCHAFFEMITIAL 521 Q+ W+T H + WG C+ +VY I V + +M HV F+MI + L Sbjct: 196 QKSWRTVKTKHKHRSTNDTWGRCIKGVVYYIAYVYHTRVWCIMSFHVKSEKFDMIKLPL 254 >At1g35080.1 68414.m04347 hypothetical protein Length = 386 Score = 27.9 bits (59), Expect = 8.1 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = +3 Query: 144 IDRCRSKLWTERQRDLSGWTQI 209 +DR RS LW E + GW QI Sbjct: 83 LDRSRSSLWMEPYGEDGGWVQI 104 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,171,394 Number of Sequences: 28952 Number of extensions: 378523 Number of successful extensions: 1212 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 1134 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1211 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1775300800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -