BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30590 (716 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_19442| Best HMM Match : Beach (HMM E-Value=0) 31 1.2 SB_47328| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 >SB_19442| Best HMM Match : Beach (HMM E-Value=0) Length = 796 Score = 30.7 bits (66), Expect = 1.2 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = -2 Query: 421 SKAPPIL*ALDFQMWPKLRTPF 356 SK PPI AL Q+WP++R F Sbjct: 775 SKTPPIKPALQLQVWPQIRAQF 796 >SB_47328| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1634 Score = 29.5 bits (63), Expect = 2.8 Identities = 18/65 (27%), Positives = 33/65 (50%), Gaps = 1/65 (1%) Frame = +1 Query: 367 EVLATSENPKPTESAAPLSDISIKSDTPHNKEASVNKQKRPQRLKSM-RLVCCCP*CVRT 543 E+ TS KPT + + +SDTP N+ +S + K P ++S +++ C C + Sbjct: 1547 EIQLTSTITKPTANQ-DFENQKTRSDTPQNRFSSNDNVKTPSFMQSTEQMLICISHCPAS 1605 Query: 544 DITKE 558 I ++ Sbjct: 1606 SIPRD 1610 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,041,086 Number of Sequences: 59808 Number of extensions: 342219 Number of successful extensions: 879 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 797 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 871 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1901817086 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -