BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30586 (817 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 29 0.068 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 28 0.090 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 28 0.090 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 28 0.090 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 28 0.090 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 28 0.090 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 27 0.21 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 27 0.21 AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 26 0.36 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 25 0.63 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 25 0.63 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 25 0.84 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 25 0.84 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 25 0.84 AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 25 0.84 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 25 0.84 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 25 0.84 AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 25 0.84 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 25 0.84 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 25 0.84 AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 25 1.1 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 25 1.1 AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 24 1.5 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 24 1.9 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 24 1.9 AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex det... 23 3.4 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 23 3.4 EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. 23 4.5 EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. 22 5.9 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 22 7.8 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 22 7.8 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 22 7.8 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 22 7.8 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 22 7.8 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 28.7 bits (61), Expect = 0.068 Identities = 13/55 (23%), Positives = 29/55 (52%) Frame = +3 Query: 447 HYQRQRSSLQGRDRAYG**GRKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEK 611 HY R+RS + R+R Y R+Y +++++ ++ + + + Y S + + K Sbjct: 230 HYSRERSCSRDRNREYKEKDRRYEKLHNEKEKLLEERTSRKRYSRSREREQKSYK 284 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 28.3 bits (60), Expect = 0.090 Identities = 11/43 (25%), Positives = 25/43 (58%) Frame = +3 Query: 447 HYQRQRSSLQGRDRAYG**GRKYRNEDDKQKETIQAKNALESY 575 HY R+RS + R+R Y R+Y +++++ ++ + + + Y Sbjct: 230 HYSRERSCSRDRNREYRKKDRRYEKLHNEKEKLLEERTSCKRY 272 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 28.3 bits (60), Expect = 0.090 Identities = 11/43 (25%), Positives = 25/43 (58%) Frame = +3 Query: 447 HYQRQRSSLQGRDRAYG**GRKYRNEDDKQKETIQAKNALESY 575 HY R+RS + R+R Y R+Y +++++ ++ + + + Y Sbjct: 230 HYSRERSCSRDRNREYRKKDRRYEKLHNEKEKLLEERTSCKRY 272 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 28.3 bits (60), Expect = 0.090 Identities = 11/43 (25%), Positives = 25/43 (58%) Frame = +3 Query: 447 HYQRQRSSLQGRDRAYG**GRKYRNEDDKQKETIQAKNALESY 575 HY R+RS + R+R Y R+Y +++++ ++ + + + Y Sbjct: 230 HYSRERSCSRDRNREYRKKDRRYEKLHNEKEKLLEERTSCKRY 272 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 28.3 bits (60), Expect = 0.090 Identities = 11/43 (25%), Positives = 25/43 (58%) Frame = +3 Query: 447 HYQRQRSSLQGRDRAYG**GRKYRNEDDKQKETIQAKNALESY 575 HY R+RS + R+R Y R+Y +++++ ++ + + + Y Sbjct: 230 HYSRERSCSRDRNREYRKKDRRYEKLHNEKEKLLEERTSCKRY 272 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 28.3 bits (60), Expect = 0.090 Identities = 11/43 (25%), Positives = 25/43 (58%) Frame = +3 Query: 447 HYQRQRSSLQGRDRAYG**GRKYRNEDDKQKETIQAKNALESY 575 HY R+RS + R+R Y R+Y +++++ ++ + + + Y Sbjct: 219 HYSRERSCSRDRNREYRKKDRRYEKLHNEKEKLLEERTSCKRY 261 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 27.1 bits (57), Expect = 0.21 Identities = 13/54 (24%), Positives = 28/54 (51%) Frame = +3 Query: 450 YQRQRSSLQGRDRAYG**GRKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEK 611 Y R+RS + R+R Y R+Y +++K+ ++ + + + Y S + + K Sbjct: 231 YSRERSCSRDRNREYKKKDRRYEKLHNEKKKLLEERTSRKRYSRSREREQKSYK 284 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 27.1 bits (57), Expect = 0.21 Identities = 13/54 (24%), Positives = 28/54 (51%) Frame = +3 Query: 450 YQRQRSSLQGRDRAYG**GRKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEK 611 Y R+RS + R+R Y R+Y +++++ ++ + + E Y S + + K Sbjct: 231 YSRERSCSRDRNREYRKKDRRYEKLHNEKEKLLEERTSRERYSRSREREQKSYK 284 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 26.2 bits (55), Expect = 0.36 Identities = 13/63 (20%), Positives = 29/63 (46%) Frame = +3 Query: 423 HQQGEQDHHYQRQRSSLQGRDRAYG**GRKYRNEDDKQKETIQAKNALESYCFSMKSTME 602 H Y R+RS + R+R Y R+Y +++++ ++ + + + Y S + + Sbjct: 222 HDFQHTSSRYSRERSCSRDRNREYKEKDRRYEKLHNEKEKLLEERTSRKRYSCSREREQK 281 Query: 603 DEK 611 K Sbjct: 282 SYK 284 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 25.4 bits (53), Expect = 0.63 Identities = 12/54 (22%), Positives = 28/54 (51%) Frame = +3 Query: 450 YQRQRSSLQGRDRAYG**GRKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEK 611 Y R+RS + R+R Y R+Y +++++ ++ + + + Y S + + K Sbjct: 231 YSRERSCSRDRNREYRKKDRRYEKLHNEKEKLLEERTSRKRYSRSREREQKSYK 284 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 25.4 bits (53), Expect = 0.63 Identities = 12/54 (22%), Positives = 28/54 (51%) Frame = +3 Query: 450 YQRQRSSLQGRDRAYG**GRKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEK 611 Y R+RS + R+R Y R+Y +++++ ++ + + + Y S + + K Sbjct: 236 YSRERSCSRDRNREYRKKDRRYEKLHNEKEKLLEERTSRKRYSRSREREQKSYK 289 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 25.0 bits (52), Expect = 0.84 Identities = 12/54 (22%), Positives = 27/54 (50%) Frame = +3 Query: 450 YQRQRSSLQGRDRAYG**GRKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEK 611 Y R+RS + R+R Y R+Y +++++ ++ + + + Y S + K Sbjct: 220 YSRERSCSRDRNREYKEKDRRYEKLHNEKEKLLEERTSRKRYSRSREREQNSYK 273 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 25.0 bits (52), Expect = 0.84 Identities = 10/42 (23%), Positives = 24/42 (57%) Frame = +3 Query: 450 YQRQRSSLQGRDRAYG**GRKYRNEDDKQKETIQAKNALESY 575 Y R+RS + R+R Y R+Y +++++ ++ + + + Y Sbjct: 231 YSRERSCSRDRNREYRKKDRRYEKLHNEKEKLLEERTSCKRY 272 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 25.0 bits (52), Expect = 0.84 Identities = 12/54 (22%), Positives = 27/54 (50%) Frame = +3 Query: 450 YQRQRSSLQGRDRAYG**GRKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEK 611 Y R+RS + R+R Y R+Y +++++ ++ + + + Y S + K Sbjct: 231 YSRERSCSRDRNREYKEKDRRYEKLHNEKEKLLEERTSRKRYSRSREREQNSYK 284 Score = 21.8 bits (44), Expect = 7.8 Identities = 13/35 (37%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Frame = +3 Query: 387 QRYPQRFRYREVHQ-QGEQDHHYQRQRSSLQGRDR 488 +RY R R RE + + E+++ R+RS + RDR Sbjct: 270 KRY-SRSREREQNSYKNEREYRKYRERSKERSRDR 303 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 25.0 bits (52), Expect = 0.84 Identities = 12/54 (22%), Positives = 28/54 (51%) Frame = +3 Query: 450 YQRQRSSLQGRDRAYG**GRKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEK 611 Y R+RS + R+R Y R+Y +++++ ++ + + + Y S + + K Sbjct: 220 YSRERSCSRDRNREYRKKDRQYEKLHNEKEKLLEERTSRKRYSRSREREQKSYK 273 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 25.0 bits (52), Expect = 0.84 Identities = 12/54 (22%), Positives = 28/54 (51%) Frame = +3 Query: 450 YQRQRSSLQGRDRAYG**GRKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEK 611 Y R+RS + R+R Y R+Y +++++ ++ + + + Y S + + K Sbjct: 231 YSRERSCSRDRNREYRKKDRQYEKLHNEKEKLLEERTSRKRYSRSREREQKSYK 284 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 25.0 bits (52), Expect = 0.84 Identities = 12/54 (22%), Positives = 28/54 (51%) Frame = +3 Query: 450 YQRQRSSLQGRDRAYG**GRKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEK 611 Y R+RS + R+R Y R+Y +++++ ++ + + + Y S + + K Sbjct: 231 YSRERSCSRDRNREYRKKDRQYEKLHNEKEKLLEERTSRKRYSRSREREQKSYK 284 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 25.0 bits (52), Expect = 0.84 Identities = 12/54 (22%), Positives = 28/54 (51%) Frame = +3 Query: 450 YQRQRSSLQGRDRAYG**GRKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEK 611 Y R+RS + R+R Y R+Y +++++ ++ + + + Y S + + K Sbjct: 220 YSRERSCSRDRNREYRKKDRQYEKLHNEKEKLLEERTSRKRYSRSREREQKSYK 273 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 25.0 bits (52), Expect = 0.84 Identities = 12/54 (22%), Positives = 28/54 (51%) Frame = +3 Query: 450 YQRQRSSLQGRDRAYG**GRKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEK 611 Y R+RS + R+R Y R+Y +++++ ++ + + + Y S + + K Sbjct: 220 YSRERSCSRDRNREYRKKDRQYEKLHNEKEKLLEERTSRKRYSRSREREQKSYK 273 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 25.0 bits (52), Expect = 0.84 Identities = 12/54 (22%), Positives = 28/54 (51%) Frame = +3 Query: 450 YQRQRSSLQGRDRAYG**GRKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEK 611 Y R+RS + R+R Y R+Y +++++ ++ + + + Y S + + K Sbjct: 231 YSRERSCSRDRNREYREKDRRYEKLHNEKEKLLEERTSRKRYSRSREREKKSYK 284 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 24.6 bits (51), Expect = 1.1 Identities = 12/54 (22%), Positives = 27/54 (50%) Frame = +3 Query: 450 YQRQRSSLQGRDRAYG**GRKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEK 611 Y R+RS + R+R Y R+Y +++++ ++ + + + Y S + K Sbjct: 220 YSRERSCSRDRNREYRKKDRQYEKLHNEKEKLLEERTSRKRYSRSREREQNSYK 273 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 24.6 bits (51), Expect = 1.1 Identities = 12/54 (22%), Positives = 27/54 (50%) Frame = +3 Query: 450 YQRQRSSLQGRDRAYG**GRKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEK 611 Y R+RS + R+R Y R+Y +++++ ++ + + + Y S + K Sbjct: 231 YSRERSCSRDRNREYRKKDRQYEKLHNEKEKLLEERTSRKRYSRSREREQNSYK 284 >AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 24.2 bits (50), Expect = 1.5 Identities = 12/54 (22%), Positives = 28/54 (51%) Frame = +3 Query: 450 YQRQRSSLQGRDRAYG**GRKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEK 611 Y R+RS + R+R Y R+Y +++++ ++ + + + Y S + + K Sbjct: 231 YSRERSCSRDRNREYRKKDRQYEKLHNEKEKFLEERTSHKRYSRSREREQKSYK 284 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 23.8 bits (49), Expect = 1.9 Identities = 10/42 (23%), Positives = 24/42 (57%) Frame = +3 Query: 450 YQRQRSSLQGRDRAYG**GRKYRNEDDKQKETIQAKNALESY 575 Y R+RS + R+R Y R+Y +++++ ++ + + + Y Sbjct: 231 YSRERSCSRDRNREYRKKDRQYEKLHNEKEKFLEERTSRKRY 272 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 23.8 bits (49), Expect = 1.9 Identities = 10/42 (23%), Positives = 24/42 (57%) Frame = +3 Query: 450 YQRQRSSLQGRDRAYG**GRKYRNEDDKQKETIQAKNALESY 575 Y R+RS + R+R Y R+Y +++++ ++ + + + Y Sbjct: 231 YSRERSCSRDRNREYRKKDRQYEKLHNEKEKFLEERTSRKRY 272 >AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 23.0 bits (47), Expect = 3.4 Identities = 12/63 (19%), Positives = 27/63 (42%) Frame = +3 Query: 423 HQQGEQDHHYQRQRSSLQGRDRAYG**GRKYRNEDDKQKETIQAKNALESYCFSMKSTME 602 H Y R+R + R+R Y R+Y +++++ ++ + + + Y S + Sbjct: 222 HDFQHTSSRYSRERRCSRDRNREYRKKDRQYEKLHNEKEKLLEERTSRKRYSRSREREQR 281 Query: 603 DEK 611 K Sbjct: 282 SYK 284 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 23.0 bits (47), Expect = 3.4 Identities = 12/68 (17%), Positives = 29/68 (42%) Frame = +3 Query: 408 RYREVHQQGEQDHHYQRQRSSLQGRDRAYG**GRKYRNEDDKQKETIQAKNALESYCFSM 587 RY ++ + + +RS + R R Y R+Y + +++ ++ + + Y S Sbjct: 233 RYEDLRHEDRNSYRNDGERSCSRDRSREYKKKDRRYDQLHNVEEKHLRERTSRRRYSRSR 292 Query: 588 KSTMEDEK 611 + + K Sbjct: 293 EREQKSYK 300 >EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. Length = 686 Score = 22.6 bits (46), Expect = 4.5 Identities = 12/42 (28%), Positives = 22/42 (52%) Frame = -1 Query: 253 SGLVIRVGGECLSLFSGDGSVTLDECGHDTSSSLNTEGKGCY 128 SG +I G+ + +++ +G L +S S+NT+ G Y Sbjct: 342 SGYLIDEYGKKIDIYTPEGLNMLGNVIEGSSDSINTKFYGMY 383 >EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. Length = 686 Score = 22.2 bits (45), Expect = 5.9 Identities = 12/42 (28%), Positives = 21/42 (50%) Frame = -1 Query: 253 SGLVIRVGGECLSLFSGDGSVTLDECGHDTSSSLNTEGKGCY 128 SG +I G+ + +++ +G L S S+NT+ G Y Sbjct: 342 SGYLIDEYGKKIDIYTPEGLNMLGNVIEGNSDSINTKFYGMY 383 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 7.8 Identities = 12/68 (17%), Positives = 28/68 (41%) Frame = +3 Query: 408 RYREVHQQGEQDHHYQRQRSSLQGRDRAYG**GRKYRNEDDKQKETIQAKNALESYCFSM 587 RY + + + +RS + R R Y R+Y + +++ ++ + + Y S Sbjct: 233 RYEDSRHEDRNSYRNDGERSCSRDRSREYKKKDRRYDQLHNVEEKHLRERTSRRRYSRSR 292 Query: 588 KSTMEDEK 611 + + K Sbjct: 293 EREQKSYK 300 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 7.8 Identities = 12/68 (17%), Positives = 28/68 (41%) Frame = +3 Query: 408 RYREVHQQGEQDHHYQRQRSSLQGRDRAYG**GRKYRNEDDKQKETIQAKNALESYCFSM 587 RY + + + +RS + R R Y R+Y + +++ ++ + + Y S Sbjct: 233 RYEDSRHEDRNSYRNDGERSCSRDRSREYKKKDRRYDQLHNVEEKHLRERTSRRRYSRSR 292 Query: 588 KSTMEDEK 611 + + K Sbjct: 293 EREQKSYK 300 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 7.8 Identities = 12/68 (17%), Positives = 28/68 (41%) Frame = +3 Query: 408 RYREVHQQGEQDHHYQRQRSSLQGRDRAYG**GRKYRNEDDKQKETIQAKNALESYCFSM 587 RY + + + +RS + R R Y R+Y + +++ ++ + + Y S Sbjct: 233 RYEDSRHEDRNSYRNDGERSCSRDRSREYKKKDRRYDQLHNVEEKHLRERTSRRRYSRSR 292 Query: 588 KSTMEDEK 611 + + K Sbjct: 293 EREQKSYK 300 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 7.8 Identities = 12/68 (17%), Positives = 28/68 (41%) Frame = +3 Query: 408 RYREVHQQGEQDHHYQRQRSSLQGRDRAYG**GRKYRNEDDKQKETIQAKNALESYCFSM 587 RY + + + +RS + R R Y R+Y + +++ ++ + + Y S Sbjct: 233 RYEDSRHEDRNSYRNDGERSCSRDRSREYKKKDRRYDQLHNVEEKHLRERTSRRRYSRSR 292 Query: 588 KSTMEDEK 611 + + K Sbjct: 293 EREQKSYK 300 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 21.8 bits (44), Expect = 7.8 Identities = 12/68 (17%), Positives = 28/68 (41%) Frame = +3 Query: 408 RYREVHQQGEQDHHYQRQRSSLQGRDRAYG**GRKYRNEDDKQKETIQAKNALESYCFSM 587 RY + + + +RS + R R Y R+Y + +++ ++ + + Y S Sbjct: 233 RYEDSRHEDRNSYRNDGERSCSRDRSREYKKKDRRYDQLHNVEEKHLRERTSRRRYSRSR 292 Query: 588 KSTMEDEK 611 + + K Sbjct: 293 EREQKSYK 300 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 231,091 Number of Sequences: 438 Number of extensions: 5370 Number of successful extensions: 39 Number of sequences better than 10.0: 34 Number of HSP's better than 10.0 without gapping: 38 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 39 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25974678 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -