BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30585 (814 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF453266-1|AAL50779.1| 116|Homo sapiens immunoglobulin heavy ch... 36 0.23 AF400158-1|AAK91718.1| 211|Homo sapiens anti-hepatitis B surfac... 36 0.23 Z14193-1|CAA78562.1| 137|Homo sapiens Ig heavy chain variable r... 34 0.53 AJ249637-1|CAB56165.1| 121|Homo sapiens immunoglobulin heavy ch... 33 1.6 AF471512-1|AAQ05687.1| 118|Homo sapiens Ig heavy chain variable... 33 1.6 X66133-1|CAA46925.1| 318|Homo sapiens AP endonuclease 1 protein. 32 2.1 U79268-1|AAB50212.1| 318|Homo sapiens apurinic/apyrimidinic end... 32 2.1 S43127-1|AAB22977.1| 318|Homo sapiens Ref-1 protein. 32 2.1 M92444-1|AAA58629.1| 318|Homo sapiens apurinic/apyrimidinic end... 32 2.1 M81955-1|AAA58372.1| 318|Homo sapiens apurinic/apyrimidinic end... 32 2.1 M80261-1|AAA58371.1| 318|Homo sapiens apurinic endonuclease pro... 32 2.1 D90373-1|BAA14381.1| 318|Homo sapiens apurinic/apyrimidinic end... 32 2.1 D13370-1|BAA02633.1| 318|Homo sapiens APEX nuclease protein. 32 2.1 BT020133-1|AAV38935.1| 318|Homo sapiens APEX nuclease (multifun... 32 2.1 BT007236-1|AAP35900.1| 318|Homo sapiens APEX nuclease (multifun... 32 2.1 BC095428-1|AAH95428.1| 318|Homo sapiens APEX nuclease (multifun... 32 2.1 BC019291-1|AAH19291.1| 318|Homo sapiens APEX nuclease (multifun... 32 2.1 BC008145-1|AAH08145.1| 318|Homo sapiens APEX nuclease (multifun... 32 2.1 BC004979-1|AAH04979.1| 318|Homo sapiens APEX nuclease (multifun... 32 2.1 BC002338-1|AAH02338.1| 318|Homo sapiens APEX nuclease (multifun... 32 2.1 AF488551-1|AAL86909.1| 318|Homo sapiens APEX nuclease (multifun... 32 2.1 X59764-1|CAA42437.1| 318|Homo sapiens HAP1 protein. 32 2.8 L08085-1|AAA98800.1| 135|Homo sapiens immunoglobulin heavy chai... 32 2.8 Y08145-1|CAA69339.1| 122|Homo sapiens heavy chain Fab fragment ... 31 3.7 DQ535377-1|ABF83320.1| 124|Homo sapiens circulating B cell anti... 31 3.7 DQ454782-1|ABE66866.1| 81|Homo sapiens immunoglobulin heavy ch... 31 3.7 AY866771-1|AAW68651.1| 119|Homo sapiens anti-tetanus toxoid imm... 31 3.7 AY971079-1|AAY18500.1| 151|Homo sapiens immunoglobulin alpha he... 31 5.0 AY866604-1|AAW68494.1| 126|Homo sapiens anti-tetanus toxoid imm... 31 5.0 AY685321-1|AAT96472.1| 123|Homo sapiens immunoglobulin variable... 31 5.0 AF471215-1|AAQ05390.1| 120|Homo sapiens Ig heavy chain variable... 31 5.0 AF062118-1|AAC18154.1| 138|Homo sapiens immunoglobulin heavy ch... 31 5.0 AY393315-1|AAR32370.1| 139|Homo sapiens immunoglobulin heavy ch... 31 6.5 AY393314-1|AAR32369.1| 129|Homo sapiens immunoglobulin heavy ch... 31 6.5 AY062322-1|AAL65750.1| 116|Homo sapiens immunoglobulin heavy ch... 31 6.5 AM233837-1|CAJ84108.1| 140|Homo sapiens immunoglobulin heavy ch... 31 6.5 AJ551077-1|CAD83001.1| 76|Homo sapiens immunoglobulin heavy ch... 31 6.5 AF193849-1|AAF35177.1| 121|Homo sapiens immunoglobulin heavy ch... 31 6.5 Z33904-1|CAA83953.1| 121|Homo sapiens Ig variable region (VDJ) ... 30 8.7 Z33902-1|CAA83951.1| 87|Homo sapiens Ig variable region (V) pr... 30 8.7 Z30546-1|CAA83021.1| 97|Homo sapiens Ig heavy chain (VH4) V re... 30 8.7 Z27504-1|CAA81824.1| 97|Homo sapiens Ig H-chain V-region (YAC-... 30 8.7 Z12342-1|CAA78212.1| 97|Homo sapiens Ig H-chain V-region (DP-... 30 8.7 Y11556-1|CAA72318.1| 88|Homo sapiens immunoglobulin heavy chai... 30 8.7 X99353-1|CAA67732.1| 110|Homo sapiens Immunoglobulin heavy chai... 30 8.7 X77472-1|CAA54620.1| 119|Homo sapiens monoclonal antibody HB4C5... 30 8.7 X70208-1|CAA49749.1| 146|Homo sapiens immunoglobulin M chain pr... 30 8.7 U22388-1|AAA66368.1| 128|Homo sapiens immunoglobulin heavy chai... 30 8.7 U00540-1|AAA17952.1| 118|Homo sapiens immunoglobulin heavy chai... 30 8.7 U00498-1|AAA17911.1| 117|Homo sapiens immunoglobulin heavy chai... 30 8.7 U00490-1|AAA17904.1| 118|Homo sapiens immunoglobulin heavy chai... 30 8.7 S73143-1|AAB30945.1| 119|Homo sapiens IgM rheumatoid factor C93... 30 8.7 M18521-1|AAA53004.1| 122|Homo sapiens immunoglobulin heavy chai... 30 8.7 M18520-1|AAA53003.1| 119|Homo sapiens immunoglobulin heavy chai... 30 8.7 EF178078-1|ABM67233.1| 122|Homo sapiens immunoglobulin heavy ch... 30 8.7 EF178016-1|ABM67171.1| 131|Homo sapiens immunoglobulin heavy ch... 30 8.7 EF178011-1|ABM67166.1| 131|Homo sapiens immunoglobulin heavy ch... 30 8.7 EF178005-1|ABM67160.1| 122|Homo sapiens immunoglobulin heavy ch... 30 8.7 EF177944-1|ABM67099.1| 119|Homo sapiens immunoglobulin heavy ch... 30 8.7 EF175410-1|ABM53242.1| 95|Homo sapiens immunoglobulin heavy ch... 30 8.7 EF091918-1|ABK80736.1| 99|Homo sapiens immunoglobulin heavy ch... 30 8.7 DQ926598-1|ABK81400.1| 117|Homo sapiens immunoglobulin heavy ch... 30 8.7 DQ840863-1|ABI74390.1| 117|Homo sapiens immunoglobulin heavy ch... 30 8.7 DQ840857-1|ABI74384.1| 117|Homo sapiens immunoglobulin heavy ch... 30 8.7 DQ840856-1|ABI74383.1| 118|Homo sapiens immunoglobulin heavy ch... 30 8.7 DQ840815-1|ABI74342.1| 120|Homo sapiens immunoglobulin heavy ch... 30 8.7 DQ535410-1|ABF83353.1| 130|Homo sapiens circulating B cell anti... 30 8.7 DQ535286-1|ABF83229.1| 126|Homo sapiens circulating B cell anti... 30 8.7 DQ535127-1|ABG38452.1| 118|Homo sapiens immunglobulin heavy cha... 30 8.7 DQ524134-1|ABI35646.1| 121|Homo sapiens immunoglobulin heavy ch... 30 8.7 DQ523926-1|ABI35438.1| 99|Homo sapiens immunoglobulin heavy ch... 30 8.7 DQ523892-1|ABI35404.1| 94|Homo sapiens immunoglobulin heavy ch... 30 8.7 DQ523889-1|ABI35401.1| 95|Homo sapiens immunoglobulin heavy ch... 30 8.7 DQ523873-1|ABI35385.1| 95|Homo sapiens immunoglobulin heavy ch... 30 8.7 DQ523869-1|ABI35381.1| 85|Homo sapiens immunoglobulin heavy ch... 30 8.7 DQ523867-1|ABI35379.1| 91|Homo sapiens immunoglobulin heavy ch... 30 8.7 DQ322974-1|ABC67096.1| 122|Homo sapiens immunoglobulin heavy ch... 30 8.7 DQ322973-1|ABC67095.1| 122|Homo sapiens immunoglobulin heavy ch... 30 8.7 DQ322972-1|ABC67094.1| 122|Homo sapiens immunoglobulin heavy ch... 30 8.7 DQ322971-1|ABC67093.1| 122|Homo sapiens immunoglobulin heavy ch... 30 8.7 DQ322969-1|ABC67091.1| 122|Homo sapiens immunoglobulin heavy ch... 30 8.7 DQ322968-1|ABC67090.1| 122|Homo sapiens immunoglobulin heavy ch... 30 8.7 DQ322877-1|ABC66999.1| 117|Homo sapiens immunoglobulin heavy ch... 30 8.7 DQ187711-1|ABA26247.1| 118|Homo sapiens immunoglobulin heavy ch... 30 8.7 DQ187673-1|ABA26209.1| 119|Homo sapiens immunoglobulin heavy ch... 30 8.7 DQ100954-1|AAZ08960.1| 114|Homo sapiens immunoglobulin heavy ch... 30 8.7 DQ100849-1|AAZ08856.1| 119|Homo sapiens immunoglobulin heavy ch... 30 8.7 DQ100813-1|AAZ08820.1| 123|Homo sapiens immunoglobulin heavy ch... 30 8.7 DQ097899-1|AAZ07879.1| 126|Homo sapiens immunoglobulin heavy ch... 30 8.7 DQ073605-1|AAZ52578.1| 118|Homo sapiens immunoglobulin heavy ch... 30 8.7 AY941915-1|AAY33264.1| 117|Homo sapiens anti-rabies virus immun... 30 8.7 AY866650-1|AAW68537.1| 126|Homo sapiens anti-tetanus toxoid imm... 30 8.7 AY866587-1|AAW68479.1| 126|Homo sapiens anti-tetanus toxoid imm... 30 8.7 AY686913-1|AAW67383.1| 119|Homo sapiens rotavirus-specific inte... 30 8.7 AY686909-1|AAW67381.1| 122|Homo sapiens rotavirus-specific inte... 30 8.7 AY640504-1|AAT65109.1| 129|Homo sapiens immunoglobulin E variab... 30 8.7 AY607550-1|AAT02146.1| 117|Homo sapiens immunoglobulin heavy ch... 30 8.7 AY607504-1|AAT02106.1| 111|Homo sapiens immunoglobulin heavy ch... 30 8.7 AY607454-1|AAT02064.1| 112|Homo sapiens immunoglobulin heavy ch... 30 8.7 AY582434-1|AAT12230.1| 97|Homo sapiens immunoglobulin heavy ch... 30 8.7 AY582407-1|AAT12208.1| 105|Homo sapiens immunoglobulin heavy ch... 30 8.7 AY530316-1|AAS19424.1| 116|Homo sapiens anti-SARS S protein imm... 30 8.7 AY530312-1|AAS19420.1| 116|Homo sapiens anti-SARS S protein imm... 30 8.7 AY430000-1|AAR38750.1| 84|Homo sapiens immunoglobulin heavy ch... 30 8.7 AY429916-1|AAR38675.1| 92|Homo sapiens immunoglobulin heavy ch... 30 8.7 AY429865-1|AAR38632.1| 82|Homo sapiens immunoglobulin heavy ch... 30 8.7 AY062306-1|AAL65734.1| 123|Homo sapiens immunoglobulin heavy ch... 30 8.7 AY003838-1|AAK11805.1| 113|Homo sapiens immunoglobulin heavy ch... 30 8.7 AY003830-1|AAK11799.1| 105|Homo sapiens immunoglobulin heavy ch... 30 8.7 AM079408-1|CAL03554.1| 100|Homo sapiens immunoglobulin heavy ch... 30 8.7 AM050923-1|CAJ19460.1| 96|Homo sapiens immunoglobulin heavy ch... 30 8.7 AJ627947-1|CAF31293.1| 123|Homo sapiens immunoglobulin heavy ch... 30 8.7 AJ551003-1|CAD82927.1| 88|Homo sapiens immunoglobulin heavy ch... 30 8.7 AJ548507-1|CAD68159.1| 145|Homo sapiens immunoglobulin heavy ch... 30 8.7 AJ536051-1|CAD59941.1| 120|Homo sapiens immunoglobulin heavy ch... 30 8.7 AJ402509-1|CAC15796.1| 84|Homo sapiens immunoglobulin heavy ch... 30 8.7 AJ402504-1|CAC15791.1| 86|Homo sapiens immunoglobulin heavy ch... 30 8.7 AJ402373-1|CAC15660.1| 73|Homo sapiens immunoglobulin heavy ch... 30 8.7 AJ347251-1|CAC87198.1| 79|Homo sapiens immunoglobulin heavy ch... 30 8.7 AJ347247-1|CAC87194.1| 83|Homo sapiens immunoglobulin heavy ch... 30 8.7 AJ275461-1|CAB87546.1| 79|Homo sapiens immunoglobulin heavy ch... 30 8.7 AJ275393-1|CAB87478.1| 83|Homo sapiens immunoglobulin heavy ch... 30 8.7 AF297160-1|AAG37211.1| 84|Homo sapiens immunoglobulin heavy ch... 30 8.7 AF174059-1|AAD53805.1| 126|Homo sapiens immunoglobulin heavy ch... 30 8.7 AF077468-1|AAC70825.1| 96|Homo sapiens immunoglobulin heavy ch... 30 8.7 AF077431-1|AAC70793.1| 94|Homo sapiens immunoglobulin heavy ch... 30 8.7 AF062235-1|AAC18271.1| 123|Homo sapiens immunoglobulin heavy ch... 30 8.7 AF062229-1|AAC18265.1| 120|Homo sapiens immunoglobulin heavy ch... 30 8.7 AF062227-1|AAC18263.1| 137|Homo sapiens immunoglobulin heavy ch... 30 8.7 AF062154-1|AAC18190.1| 138|Homo sapiens immunoglobulin heavy ch... 30 8.7 AF039297-1|AAB96673.1| 123|Homo sapiens anti-dsDNA IgM heavy ch... 30 8.7 AF035788-1|AAB88520.1| 94|Homo sapiens rheumatoid factor RF-IP... 30 8.7 AF035787-1|AAB88519.1| 94|Homo sapiens rheumatoid factor RF-IP... 30 8.7 AF017464-1|AAB81257.1| 72|Homo sapiens rearranged immunoglobul... 30 8.7 AF006525-1|AAB62920.1| 128|Homo sapiens immunoglobulin heavy ch... 30 8.7 AB019438-9|BAA75029.1| 116|Homo sapiens immunogloblin heavy cha... 30 8.7 AB001736-1|BAA19943.1| 253|Homo sapiens scFv collagenase IV ant... 30 8.7 AB001733-1|BAA19453.1| 253|Homo sapiens single-chain antibody p... 30 8.7 >AF453266-1|AAL50779.1| 116|Homo sapiens immunoglobulin heavy chain variable region protein. Length = 116 Score = 35.5 bits (78), Expect = 0.23 Identities = 15/24 (62%), Positives = 19/24 (79%), Gaps = 1/24 (4%) Frame = -2 Query: 810 SWLSAP-GKGLEFLGMEFPGGSTK 742 SW+ P GKGLE++G +PGGSTK Sbjct: 35 SWIRQPAGKGLEWIGRIYPGGSTK 58 >AF400158-1|AAK91718.1| 211|Homo sapiens anti-hepatitis B surface antigen immunoglobulin heavy chain protein. Length = 211 Score = 35.5 bits (78), Expect = 0.23 Identities = 15/24 (62%), Positives = 19/24 (79%), Gaps = 1/24 (4%) Frame = -2 Query: 810 SWLSAP-GKGLEFLGMEFPGGSTK 742 SW+ P GKGLE++G +PGGSTK Sbjct: 25 SWIRQPAGKGLEWIGRIYPGGSTK 48 >Z14193-1|CAA78562.1| 137|Homo sapiens Ig heavy chain variable region (VDJ) protein. Length = 137 Score = 34.3 bits (75), Expect = 0.53 Identities = 13/22 (59%), Positives = 17/22 (77%) Frame = -2 Query: 810 SWLSAPGKGLEFLGMEFPGGST 745 SW+ PGKGLE++G + GGST Sbjct: 56 SWIQPPGKGLEWIGYIYYGGST 77 >AJ249637-1|CAB56165.1| 121|Homo sapiens immunoglobulin heavy chain protein. Length = 121 Score = 32.7 bits (71), Expect = 1.6 Identities = 15/26 (57%), Positives = 20/26 (76%), Gaps = 2/26 (7%) Frame = -2 Query: 813 TSWL-SAPGKGLEFLGMEFPG-GSTK 742 T W+ PGKGLE++GM +PG G+TK Sbjct: 38 TGWVRQMPGKGLEWMGMIYPGDGNTK 63 >AF471512-1|AAQ05687.1| 118|Homo sapiens Ig heavy chain variable region, VH3 family protein. Length = 118 Score = 32.7 bits (71), Expect = 1.6 Identities = 14/23 (60%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ APGKGLE++ +PGGST Sbjct: 35 SWVRQAPGKGLEWVSTIYPGGST 57 >X66133-1|CAA46925.1| 318|Homo sapiens AP endonuclease 1 protein. Length = 318 Score = 32.3 bits (70), Expect = 2.1 Identities = 18/53 (33%), Positives = 26/53 (49%), Gaps = 4/53 (7%) Frame = +1 Query: 319 FKKFLDGVCTEKPTVQCETFKTKSEGELVEIKNPRFPHKNT----QEESGISE 465 F+KFL G+ + KP V C E ++++NP+ KN QE G E Sbjct: 192 FRKFLKGLASRKPLVLCGDLNVAHEE--IDLRNPKGNKKNAGFTPQERQGFGE 242 >U79268-1|AAB50212.1| 318|Homo sapiens apurinic/apyrimidinic endonuclease protein. Length = 318 Score = 32.3 bits (70), Expect = 2.1 Identities = 18/53 (33%), Positives = 26/53 (49%), Gaps = 4/53 (7%) Frame = +1 Query: 319 FKKFLDGVCTEKPTVQCETFKTKSEGELVEIKNPRFPHKNT----QEESGISE 465 F+KFL G+ + KP V C E ++++NP+ KN QE G E Sbjct: 192 FRKFLKGLASRKPLVLCGDLNVAHEE--IDLRNPKGNKKNAGFTPQERQGFGE 242 >S43127-1|AAB22977.1| 318|Homo sapiens Ref-1 protein. Length = 318 Score = 32.3 bits (70), Expect = 2.1 Identities = 18/53 (33%), Positives = 26/53 (49%), Gaps = 4/53 (7%) Frame = +1 Query: 319 FKKFLDGVCTEKPTVQCETFKTKSEGELVEIKNPRFPHKNT----QEESGISE 465 F+KFL G+ + KP V C E ++++NP+ KN QE G E Sbjct: 192 FRKFLKGLASRKPLVLCGDLNVAHEE--IDLRNPKGNKKNAGFTPQERQGFGE 242 >M92444-1|AAA58629.1| 318|Homo sapiens apurinic/apyrimidinic endonuclease protein. Length = 318 Score = 32.3 bits (70), Expect = 2.1 Identities = 18/53 (33%), Positives = 26/53 (49%), Gaps = 4/53 (7%) Frame = +1 Query: 319 FKKFLDGVCTEKPTVQCETFKTKSEGELVEIKNPRFPHKNT----QEESGISE 465 F+KFL G+ + KP V C E ++++NP+ KN QE G E Sbjct: 192 FRKFLKGLASRKPLVLCGDLNVAHEE--IDLRNPKGNKKNAGFTPQERQGFGE 242 >M81955-1|AAA58372.1| 318|Homo sapiens apurinic/apyrimidinic endonuclease protein. Length = 318 Score = 32.3 bits (70), Expect = 2.1 Identities = 18/53 (33%), Positives = 26/53 (49%), Gaps = 4/53 (7%) Frame = +1 Query: 319 FKKFLDGVCTEKPTVQCETFKTKSEGELVEIKNPRFPHKNT----QEESGISE 465 F+KFL G+ + KP V C E ++++NP+ KN QE G E Sbjct: 192 FRKFLKGLASRKPLVLCGDLNVAHEE--IDLRNPKGNKKNAGFTPQERQGFGE 242 >M80261-1|AAA58371.1| 318|Homo sapiens apurinic endonuclease protein. Length = 318 Score = 32.3 bits (70), Expect = 2.1 Identities = 18/53 (33%), Positives = 26/53 (49%), Gaps = 4/53 (7%) Frame = +1 Query: 319 FKKFLDGVCTEKPTVQCETFKTKSEGELVEIKNPRFPHKNT----QEESGISE 465 F+KFL G+ + KP V C E ++++NP+ KN QE G E Sbjct: 192 FRKFLKGLASRKPLVLCGDLNVAHEE--IDLRNPKGNKKNAGFTPQERQGFGE 242 >D90373-1|BAA14381.1| 318|Homo sapiens apurinic/apyrimidinic endonuclease protein. Length = 318 Score = 32.3 bits (70), Expect = 2.1 Identities = 18/53 (33%), Positives = 26/53 (49%), Gaps = 4/53 (7%) Frame = +1 Query: 319 FKKFLDGVCTEKPTVQCETFKTKSEGELVEIKNPRFPHKNT----QEESGISE 465 F+KFL G+ + KP V C E ++++NP+ KN QE G E Sbjct: 192 FRKFLKGLASRKPLVLCGDLNVAHEE--IDLRNPKGNKKNAGFTPQERQGFGE 242 >D13370-1|BAA02633.1| 318|Homo sapiens APEX nuclease protein. Length = 318 Score = 32.3 bits (70), Expect = 2.1 Identities = 18/53 (33%), Positives = 26/53 (49%), Gaps = 4/53 (7%) Frame = +1 Query: 319 FKKFLDGVCTEKPTVQCETFKTKSEGELVEIKNPRFPHKNT----QEESGISE 465 F+KFL G+ + KP V C E ++++NP+ KN QE G E Sbjct: 192 FRKFLKGLASRKPLVLCGDLNVAHEE--IDLRNPKGNKKNAGFTPQERQGFGE 242 >BT020133-1|AAV38935.1| 318|Homo sapiens APEX nuclease (multifunctional DNA repair enzyme) 1 protein. Length = 318 Score = 32.3 bits (70), Expect = 2.1 Identities = 18/53 (33%), Positives = 26/53 (49%), Gaps = 4/53 (7%) Frame = +1 Query: 319 FKKFLDGVCTEKPTVQCETFKTKSEGELVEIKNPRFPHKNT----QEESGISE 465 F+KFL G+ + KP V C E ++++NP+ KN QE G E Sbjct: 192 FRKFLKGLASRKPLVLCGDLNVAHEE--IDLRNPKGNKKNAGFTPQERQGFGE 242 >BT007236-1|AAP35900.1| 318|Homo sapiens APEX nuclease (multifunctional DNA repair enzyme) 1 protein. Length = 318 Score = 32.3 bits (70), Expect = 2.1 Identities = 18/53 (33%), Positives = 26/53 (49%), Gaps = 4/53 (7%) Frame = +1 Query: 319 FKKFLDGVCTEKPTVQCETFKTKSEGELVEIKNPRFPHKNT----QEESGISE 465 F+KFL G+ + KP V C E ++++NP+ KN QE G E Sbjct: 192 FRKFLKGLASRKPLVLCGDLNVAHEE--IDLRNPKGNKKNAGFTPQERQGFGE 242 >BC095428-1|AAH95428.1| 318|Homo sapiens APEX nuclease (multifunctional DNA repair enzyme) 1 protein. Length = 318 Score = 32.3 bits (70), Expect = 2.1 Identities = 18/53 (33%), Positives = 26/53 (49%), Gaps = 4/53 (7%) Frame = +1 Query: 319 FKKFLDGVCTEKPTVQCETFKTKSEGELVEIKNPRFPHKNT----QEESGISE 465 F+KFL G+ + KP V C E ++++NP+ KN QE G E Sbjct: 192 FRKFLKGLASRKPLVLCGDLNVAHEE--IDLRNPKGNKKNAGFTPQERQGFGE 242 >BC019291-1|AAH19291.1| 318|Homo sapiens APEX nuclease (multifunctional DNA repair enzyme) 1 protein. Length = 318 Score = 32.3 bits (70), Expect = 2.1 Identities = 18/53 (33%), Positives = 26/53 (49%), Gaps = 4/53 (7%) Frame = +1 Query: 319 FKKFLDGVCTEKPTVQCETFKTKSEGELVEIKNPRFPHKNT----QEESGISE 465 F+KFL G+ + KP V C E ++++NP+ KN QE G E Sbjct: 192 FRKFLKGLASRKPLVLCGDLNVAHEE--IDLRNPKGNKKNAGFTPQERQGFGE 242 >BC008145-1|AAH08145.1| 318|Homo sapiens APEX nuclease (multifunctional DNA repair enzyme) 1 protein. Length = 318 Score = 32.3 bits (70), Expect = 2.1 Identities = 18/53 (33%), Positives = 26/53 (49%), Gaps = 4/53 (7%) Frame = +1 Query: 319 FKKFLDGVCTEKPTVQCETFKTKSEGELVEIKNPRFPHKNT----QEESGISE 465 F+KFL G+ + KP V C E ++++NP+ KN QE G E Sbjct: 192 FRKFLKGLASRKPLVLCGDLNVAHEE--IDLRNPKGNKKNAGFTPQERQGFGE 242 >BC004979-1|AAH04979.1| 318|Homo sapiens APEX nuclease (multifunctional DNA repair enzyme) 1 protein. Length = 318 Score = 32.3 bits (70), Expect = 2.1 Identities = 18/53 (33%), Positives = 26/53 (49%), Gaps = 4/53 (7%) Frame = +1 Query: 319 FKKFLDGVCTEKPTVQCETFKTKSEGELVEIKNPRFPHKNT----QEESGISE 465 F+KFL G+ + KP V C E ++++NP+ KN QE G E Sbjct: 192 FRKFLKGLASRKPLVLCGDLNVAHEE--IDLRNPKGNKKNAGFTPQERQGFGE 242 >BC002338-1|AAH02338.1| 318|Homo sapiens APEX nuclease (multifunctional DNA repair enzyme) 1 protein. Length = 318 Score = 32.3 bits (70), Expect = 2.1 Identities = 18/53 (33%), Positives = 26/53 (49%), Gaps = 4/53 (7%) Frame = +1 Query: 319 FKKFLDGVCTEKPTVQCETFKTKSEGELVEIKNPRFPHKNT----QEESGISE 465 F+KFL G+ + KP V C E ++++NP+ KN QE G E Sbjct: 192 FRKFLKGLASRKPLVLCGDLNVAHEE--IDLRNPKGNKKNAGFTPQERQGFGE 242 >AF488551-1|AAL86909.1| 318|Homo sapiens APEX nuclease (multifunctional DNA repair enzyme) protein. Length = 318 Score = 32.3 bits (70), Expect = 2.1 Identities = 18/53 (33%), Positives = 26/53 (49%), Gaps = 4/53 (7%) Frame = +1 Query: 319 FKKFLDGVCTEKPTVQCETFKTKSEGELVEIKNPRFPHKNT----QEESGISE 465 F+KFL G+ + KP V C E ++++NP+ KN QE G E Sbjct: 192 FRKFLKGLASRKPLVLCGDLNVAHEE--IDLRNPKGNKKNAGFTPQERQGFGE 242 >X59764-1|CAA42437.1| 318|Homo sapiens HAP1 protein. Length = 318 Score = 31.9 bits (69), Expect = 2.8 Identities = 18/53 (33%), Positives = 26/53 (49%), Gaps = 4/53 (7%) Frame = +1 Query: 319 FKKFLDGVCTEKPTVQCETFKTKSEGELVEIKNPRFPHKNT----QEESGISE 465 F+KFL G+ + KP V C E ++++NP+ KN QE G E Sbjct: 192 FRKFLKGLASRKPLVLCGDLNVAHEE--IDLRNPKGNKKNAGFTPQEAQGFGE 242 >L08085-1|AAA98800.1| 135|Homo sapiens immunoglobulin heavy chain VH-III region protein. Length = 135 Score = 31.9 bits (69), Expect = 2.8 Identities = 14/23 (60%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ APGKGLE++ M + GGST Sbjct: 54 SWVRQAPGKGLEWVSMIYSGGST 76 >Y08145-1|CAA69339.1| 122|Homo sapiens heavy chain Fab fragment protein. Length = 122 Score = 31.5 bits (68), Expect = 3.7 Identities = 13/24 (54%), Positives = 17/24 (70%), Gaps = 1/24 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGSTK 742 +WL PGKGLE++G + GG TK Sbjct: 35 TWLRQTPGKGLEWIGFVYDGGRTK 58 >DQ535377-1|ABF83320.1| 124|Homo sapiens circulating B cell antibody heavy chain variable region protein. Length = 124 Score = 31.5 bits (68), Expect = 3.7 Identities = 14/23 (60%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ APGKGLE++ + F GGST Sbjct: 37 SWVRQAPGKGLEWVSVIFSGGST 59 >DQ454782-1|ABE66866.1| 81|Homo sapiens immunoglobulin heavy chain variable region protein. Length = 81 Score = 31.5 bits (68), Expect = 3.7 Identities = 14/23 (60%), Positives = 17/23 (73%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ PGKGLE++G F GGST Sbjct: 2 SWIRQPPGKGLEYIGNIFYGGST 24 >AY866771-1|AAW68651.1| 119|Homo sapiens anti-tetanus toxoid immunoglobulin heavy chain variable region protein. Length = 119 Score = 31.5 bits (68), Expect = 3.7 Identities = 13/23 (56%), Positives = 17/23 (73%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ PGKGLE++G +P GST Sbjct: 37 SWIRQPPGKGLEWIGYIYPSGST 59 >AY971079-1|AAY18500.1| 151|Homo sapiens immunoglobulin alpha heavy chain variable region protein. Length = 151 Score = 31.1 bits (67), Expect = 5.0 Identities = 13/24 (54%), Positives = 18/24 (75%), Gaps = 1/24 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGSTK 742 SW+ +PGKGLE++G + GSTK Sbjct: 36 SWVRQSPGKGLEWIGYVYSSGSTK 59 >AY866604-1|AAW68494.1| 126|Homo sapiens anti-tetanus toxoid immunoglobulin heavy chain variable region protein. Length = 126 Score = 31.1 bits (67), Expect = 5.0 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = -2 Query: 795 PGKGLEFLGMEFPGGS 748 PGKGLE+LGM +PG S Sbjct: 41 PGKGLEWLGMTYPGDS 56 >AY685321-1|AAT96472.1| 123|Homo sapiens immunoglobulin variable region VH gamma domain protein. Length = 123 Score = 31.1 bits (67), Expect = 5.0 Identities = 13/23 (56%), Positives = 17/23 (73%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ APGKGLEF+ + + GG T Sbjct: 35 SWVRQAPGKGLEFVSLLYTGGDT 57 >AF471215-1|AAQ05390.1| 120|Homo sapiens Ig heavy chain variable region, VH3 family protein. Length = 120 Score = 31.1 bits (67), Expect = 5.0 Identities = 14/24 (58%), Positives = 18/24 (75%), Gaps = 1/24 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGSTK 742 SW+ APGKGLE++ M PGG+ K Sbjct: 35 SWVRQAPGKGLEWVAMINPGGNDK 58 >AF062118-1|AAC18154.1| 138|Homo sapiens immunoglobulin heavy chain variable region protein. Length = 138 Score = 31.1 bits (67), Expect = 5.0 Identities = 12/23 (52%), Positives = 19/23 (82%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 +W+ APGKGLE++ + +PGG+T Sbjct: 54 TWVRQAPGKGLEWVSILYPGGNT 76 >AY393315-1|AAR32370.1| 139|Homo sapiens immunoglobulin heavy chain variable region protein. Length = 139 Score = 30.7 bits (66), Expect = 6.5 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = -2 Query: 795 PGKGLEFLGMEFPGGS 748 PGKGLE++GM FPG S Sbjct: 37 PGKGLEWMGMIFPGDS 52 >AY393314-1|AAR32369.1| 129|Homo sapiens immunoglobulin heavy chain variable region protein. Length = 129 Score = 30.7 bits (66), Expect = 6.5 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = -2 Query: 795 PGKGLEFLGMEFPGGS 748 PGKGLE++GM FPG S Sbjct: 37 PGKGLEWMGMIFPGDS 52 >AY062322-1|AAL65750.1| 116|Homo sapiens immunoglobulin heavy chain variable region protein. Length = 116 Score = 30.7 bits (66), Expect = 6.5 Identities = 11/16 (68%), Positives = 15/16 (93%) Frame = -2 Query: 795 PGKGLEFLGMEFPGGS 748 PGKGLE++G+ +PGGS Sbjct: 36 PGKGLEWMGIIYPGGS 51 >AM233837-1|CAJ84108.1| 140|Homo sapiens immunoglobulin heavy chain variable region protein. Length = 140 Score = 30.7 bits (66), Expect = 6.5 Identities = 14/26 (53%), Positives = 19/26 (73%), Gaps = 4/26 (15%) Frame = -2 Query: 813 TSWLS----APGKGLEFLGMEFPGGS 748 TSW++ PGKGLE+LG+ +PG S Sbjct: 50 TSWIAWVRQMPGKGLEWLGIIYPGDS 75 >AJ551077-1|CAD83001.1| 76|Homo sapiens immunoglobulin heavy chain protein. Length = 76 Score = 30.7 bits (66), Expect = 6.5 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ APGKGLE++ + + GGST Sbjct: 3 SWVRQAPGKGLEWISVFYKGGST 25 >AF193849-1|AAF35177.1| 121|Homo sapiens immunoglobulin heavy chain variable region protein. Length = 121 Score = 30.7 bits (66), Expect = 6.5 Identities = 13/24 (54%), Positives = 18/24 (75%), Gaps = 1/24 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGSTK 742 +W+ APGKG+E+L + GGSTK Sbjct: 35 AWVRKAPGKGMEWLSSIYSGGSTK 58 >Z33904-1|CAA83953.1| 121|Homo sapiens Ig variable region (VDJ) protein. Length = 121 Score = 30.3 bits (65), Expect = 8.7 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ APGKGLE++ + + GGST Sbjct: 35 SWVRQAPGKGLEWVSVIYSGGST 57 >Z33902-1|CAA83951.1| 87|Homo sapiens Ig variable region (V) protein. Length = 87 Score = 30.3 bits (65), Expect = 8.7 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ APGKGLE++ + + GGST Sbjct: 35 SWVRQAPGKGLEWVSVIYSGGST 57 >Z30546-1|CAA83021.1| 97|Homo sapiens Ig heavy chain (VH4) V region (VDJ) protein. Length = 97 Score = 30.3 bits (65), Expect = 8.7 Identities = 13/23 (56%), Positives = 17/23 (73%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWLSAP-GKGLEFLGMEFPGGST 745 SW+ P GKGLE++G + GGST Sbjct: 10 SWIRQPAGKGLEWIGRIYTGGST 32 >Z27504-1|CAA81824.1| 97|Homo sapiens Ig H-chain V-region (YAC-5) protein. Length = 97 Score = 30.3 bits (65), Expect = 8.7 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ APGKGLE++ + + GGST Sbjct: 35 SWVRQAPGKGLEWVSVIYSGGST 57 >Z12342-1|CAA78212.1| 97|Homo sapiens Ig H-chain V-region (DP-42) protein. Length = 97 Score = 30.3 bits (65), Expect = 8.7 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ APGKGLE++ + + GGST Sbjct: 35 SWVRQAPGKGLEWVSVIYSGGST 57 >Y11556-1|CAA72318.1| 88|Homo sapiens immunoglobulin heavy chain protein. Length = 88 Score = 30.3 bits (65), Expect = 8.7 Identities = 11/17 (64%), Positives = 15/17 (88%) Frame = -2 Query: 795 PGKGLEFLGMEFPGGST 745 PGKGLE++G+ +PG ST Sbjct: 21 PGKGLEWMGVVYPGDST 37 >X99353-1|CAA67732.1| 110|Homo sapiens Immunoglobulin heavy chain protein. Length = 110 Score = 30.3 bits (65), Expect = 8.7 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ APGKGLE++ + + GGST Sbjct: 35 SWVRQAPGKGLEWVSVIYSGGST 57 >X77472-1|CAA54620.1| 119|Homo sapiens monoclonal antibody HB4C5 heavy chain protein. Length = 119 Score = 30.3 bits (65), Expect = 8.7 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ APGKGLE++ + + GGST Sbjct: 35 SWVRQAPGKGLEWVSVIYSGGST 57 >X70208-1|CAA49749.1| 146|Homo sapiens immunoglobulin M chain protein. Length = 146 Score = 30.3 bits (65), Expect = 8.7 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ APGKGLE++ + + GGST Sbjct: 54 SWVRQAPGKGLEWVSVIYSGGST 76 >U22388-1|AAA66368.1| 128|Homo sapiens immunoglobulin heavy chain protein. Length = 128 Score = 30.3 bits (65), Expect = 8.7 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ APGKGLE++ + + GGST Sbjct: 35 SWVRQAPGKGLEWVSVIYSGGST 57 >U00540-1|AAA17952.1| 118|Homo sapiens immunoglobulin heavy chain variable region protein. Length = 118 Score = 30.3 bits (65), Expect = 8.7 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ APGKGLE++ + + GGST Sbjct: 35 SWVRQAPGKGLEWVSVIYSGGST 57 >U00498-1|AAA17911.1| 117|Homo sapiens immunoglobulin heavy chain variable region protein. Length = 117 Score = 30.3 bits (65), Expect = 8.7 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ APGKGLE++ + + GGST Sbjct: 35 SWVRQAPGKGLEWVSVIYSGGST 57 >U00490-1|AAA17904.1| 118|Homo sapiens immunoglobulin heavy chain variable region protein. Length = 118 Score = 30.3 bits (65), Expect = 8.7 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ APGKGLE++ + + GGST Sbjct: 35 SWVRQAPGKGLEWVSVIYSGGST 57 >S73143-1|AAB30945.1| 119|Homo sapiens IgM rheumatoid factor C93 protein. Length = 119 Score = 30.3 bits (65), Expect = 8.7 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ APGKGLE++ + + GGST Sbjct: 28 SWVRQAPGKGLEWVSVIYSGGST 50 >M18521-1|AAA53004.1| 122|Homo sapiens immunoglobulin heavy chain protein. Length = 122 Score = 30.3 bits (65), Expect = 8.7 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ APGKGLE++ + + GGST Sbjct: 37 SWVRQAPGKGLEWVSVIYSGGST 59 >M18520-1|AAA53003.1| 119|Homo sapiens immunoglobulin heavy chain protein. Length = 119 Score = 30.3 bits (65), Expect = 8.7 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ APGKGLE++ + + GGST Sbjct: 37 SWVRQAPGKGLEWVSVIYSGGST 59 >EF178078-1|ABM67233.1| 122|Homo sapiens immunoglobulin heavy chain variable region protein. Length = 122 Score = 30.3 bits (65), Expect = 8.7 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ APGKGLE++ + + GGST Sbjct: 37 SWVRQAPGKGLEWVSVIYSGGST 59 >EF178016-1|ABM67171.1| 131|Homo sapiens immunoglobulin heavy chain variable region protein. Length = 131 Score = 30.3 bits (65), Expect = 8.7 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ APGKGLE++ + + GGST Sbjct: 37 SWVRQAPGKGLEWVSVIYSGGST 59 >EF178011-1|ABM67166.1| 131|Homo sapiens immunoglobulin heavy chain variable region protein. Length = 131 Score = 30.3 bits (65), Expect = 8.7 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ APGKGLE++ + + GGST Sbjct: 37 SWVRQAPGKGLEWVSVIYSGGST 59 >EF178005-1|ABM67160.1| 122|Homo sapiens immunoglobulin heavy chain variable region protein. Length = 122 Score = 30.3 bits (65), Expect = 8.7 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ APGKGLE++ + + GGST Sbjct: 37 SWVRQAPGKGLEWVSVIYSGGST 59 >EF177944-1|ABM67099.1| 119|Homo sapiens immunoglobulin heavy chain variable region protein. Length = 119 Score = 30.3 bits (65), Expect = 8.7 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ APGKGLE++ + + GGST Sbjct: 37 SWVRQAPGKGLEWVSVIYSGGST 59 >EF175410-1|ABM53242.1| 95|Homo sapiens immunoglobulin heavy chain variable region protein. Length = 95 Score = 30.3 bits (65), Expect = 8.7 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ APGKGLE++ + + GGST Sbjct: 13 SWVRQAPGKGLEWVSVIYSGGST 35 >EF091918-1|ABK80736.1| 99|Homo sapiens immunoglobulin heavy chain variable region protein. Length = 99 Score = 30.3 bits (65), Expect = 8.7 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ APGKGLE++ + + GGST Sbjct: 13 SWVRQAPGKGLEWVSVIYSGGST 35 >DQ926598-1|ABK81400.1| 117|Homo sapiens immunoglobulin heavy chain variable region protein. Length = 117 Score = 30.3 bits (65), Expect = 8.7 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ APGKGLE++ + + GGST Sbjct: 35 SWVRQAPGKGLEWVSVIYSGGST 57 >DQ840863-1|ABI74390.1| 117|Homo sapiens immunoglobulin heavy chain variable region protein. Length = 117 Score = 30.3 bits (65), Expect = 8.7 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ APGKGLE++ + + GGST Sbjct: 35 SWVRQAPGKGLEWVSVIYSGGST 57 >DQ840857-1|ABI74384.1| 117|Homo sapiens immunoglobulin heavy chain variable region protein. Length = 117 Score = 30.3 bits (65), Expect = 8.7 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ APGKGLE++ + + GGST Sbjct: 35 SWVRQAPGKGLEWVSVIYSGGST 57 >DQ840856-1|ABI74383.1| 118|Homo sapiens immunoglobulin heavy chain variable region protein. Length = 118 Score = 30.3 bits (65), Expect = 8.7 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ APGKGLE++ + + GGST Sbjct: 35 SWVRQAPGKGLEWVSVIYSGGST 57 >DQ840815-1|ABI74342.1| 120|Homo sapiens immunoglobulin heavy chain variable region protein. Length = 120 Score = 30.3 bits (65), Expect = 8.7 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ APGKGLE++ + + GGST Sbjct: 35 SWVRQAPGKGLEWVSVIYSGGST 57 >DQ535410-1|ABF83353.1| 130|Homo sapiens circulating B cell antibody heavy chain variable region protein. Length = 130 Score = 30.3 bits (65), Expect = 8.7 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ APGKGLE++ + + GGST Sbjct: 37 SWVRQAPGKGLEWVSVIYSGGST 59 >DQ535286-1|ABF83229.1| 126|Homo sapiens circulating B cell antibody heavy chain variable region protein. Length = 126 Score = 30.3 bits (65), Expect = 8.7 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ APGKGLE++ + + GGST Sbjct: 37 SWVRQAPGKGLEWVSVIYSGGST 59 >DQ535127-1|ABG38452.1| 118|Homo sapiens immunglobulin heavy chain variable region protein. Length = 118 Score = 30.3 bits (65), Expect = 8.7 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ APGKGLE++ + + GGST Sbjct: 36 SWVRQAPGKGLEWVSVIYSGGST 58 >DQ524134-1|ABI35646.1| 121|Homo sapiens immunoglobulin heavy chain variable region protein. Length = 121 Score = 30.3 bits (65), Expect = 8.7 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ APGKGLE++ + + GGST Sbjct: 34 SWVRQAPGKGLEWVSVIYSGGST 56 >DQ523926-1|ABI35438.1| 99|Homo sapiens immunoglobulin heavy chain variable region protein. Length = 99 Score = 30.3 bits (65), Expect = 8.7 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ APGKGLE++ + + GGST Sbjct: 11 SWVRQAPGKGLEWVSVIYSGGST 33 >DQ523892-1|ABI35404.1| 94|Homo sapiens immunoglobulin heavy chain variable region protein. Length = 94 Score = 30.3 bits (65), Expect = 8.7 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ APGKGLE++ + + GGST Sbjct: 9 SWVRQAPGKGLEWVSVIYSGGST 31 >DQ523889-1|ABI35401.1| 95|Homo sapiens immunoglobulin heavy chain variable region protein. Length = 95 Score = 30.3 bits (65), Expect = 8.7 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ APGKGLE++ + + GGST Sbjct: 7 SWVRQAPGKGLEWVSVIYSGGST 29 >DQ523873-1|ABI35385.1| 95|Homo sapiens immunoglobulin heavy chain variable region protein. Length = 95 Score = 30.3 bits (65), Expect = 8.7 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ APGKGLE++ + + GGST Sbjct: 10 SWVRQAPGKGLEWVSVIYSGGST 32 >DQ523869-1|ABI35381.1| 85|Homo sapiens immunoglobulin heavy chain variable region protein. Length = 85 Score = 30.3 bits (65), Expect = 8.7 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ APGKGLE++ + + GGST Sbjct: 2 SWVRQAPGKGLEWVSVIYSGGST 24 >DQ523867-1|ABI35379.1| 91|Homo sapiens immunoglobulin heavy chain variable region protein. Length = 91 Score = 30.3 bits (65), Expect = 8.7 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ APGKGLE++ + + GGST Sbjct: 8 SWVRQAPGKGLEWVSVIYSGGST 30 >DQ322974-1|ABC67096.1| 122|Homo sapiens immunoglobulin heavy chain variable region YV1-14-VH3-60 protein. Length = 122 Score = 30.3 bits (65), Expect = 8.7 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ APGKGLE++ + + GGST Sbjct: 36 SWVRQAPGKGLEWVSIIYSGGST 58 >DQ322973-1|ABC67095.1| 122|Homo sapiens immunoglobulin heavy chain variable region YV1-14-VH3-59 protein. Length = 122 Score = 30.3 bits (65), Expect = 8.7 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ APGKGLE++ + + GGST Sbjct: 36 SWVRQAPGKGLEWVSIIYSGGST 58 >DQ322972-1|ABC67094.1| 122|Homo sapiens immunoglobulin heavy chain variable region YV1-14-VH3-58 protein. Length = 122 Score = 30.3 bits (65), Expect = 8.7 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ APGKGLE++ + + GGST Sbjct: 36 SWVRQAPGKGLEWVSIIYSGGST 58 >DQ322971-1|ABC67093.1| 122|Homo sapiens immunoglobulin heavy chain variable region YV1-14-VH3-57 protein. Length = 122 Score = 30.3 bits (65), Expect = 8.7 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ APGKGLE++ + + GGST Sbjct: 36 SWVRQAPGKGLEWVSIIYSGGST 58 >DQ322969-1|ABC67091.1| 122|Homo sapiens immunoglobulin heavy chain variable region YV1-14-VH3-52 protein. Length = 122 Score = 30.3 bits (65), Expect = 8.7 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ APGKGLE++ + + GGST Sbjct: 36 SWVRQAPGKGLEWVSIIYSGGST 58 >DQ322968-1|ABC67090.1| 122|Homo sapiens immunoglobulin heavy chain variable region YV1-14-VH3-51 protein. Length = 122 Score = 30.3 bits (65), Expect = 8.7 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ APGKGLE++ + + GGST Sbjct: 36 SWVRQAPGKGLEWVSIIYSGGST 58 >DQ322877-1|ABC66999.1| 117|Homo sapiens immunoglobulin heavy chain variable region EV3-4-VH3-4 protein. Length = 117 Score = 30.3 bits (65), Expect = 8.7 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ APGKGLE++ + + GGST Sbjct: 36 SWVRQAPGKGLEWVSVIYSGGST 58 >DQ187711-1|ABA26247.1| 118|Homo sapiens immunoglobulin heavy chain variable region protein. Length = 118 Score = 30.3 bits (65), Expect = 8.7 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ APGKGLE++ + + GGST Sbjct: 34 SWVRQAPGKGLEWVSVIYSGGST 56 >DQ187673-1|ABA26209.1| 119|Homo sapiens immunoglobulin heavy chain variable region protein. Length = 119 Score = 30.3 bits (65), Expect = 8.7 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ APGKGLE++ + + GGST Sbjct: 35 SWVRQAPGKGLEWVSVIYSGGST 57 >DQ100954-1|AAZ08960.1| 114|Homo sapiens immunoglobulin heavy chain variable region protein. Length = 114 Score = 30.3 bits (65), Expect = 8.7 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = -2 Query: 795 PGKGLEFLGMEFPGGS 748 PGKGLE+LGM +PG S Sbjct: 40 PGKGLEWLGMIYPGDS 55 >DQ100849-1|AAZ08856.1| 119|Homo sapiens immunoglobulin heavy chain variable region protein. Length = 119 Score = 30.3 bits (65), Expect = 8.7 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ APGKGLE++ + + GGST Sbjct: 34 SWVRQAPGKGLEWVSVIYSGGST 56 >DQ100813-1|AAZ08820.1| 123|Homo sapiens immunoglobulin heavy chain variable region protein. Length = 123 Score = 30.3 bits (65), Expect = 8.7 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ APGKGLE++ + + GGST Sbjct: 33 SWVRQAPGKGLEWVSVIYSGGST 55 >DQ097899-1|AAZ07879.1| 126|Homo sapiens immunoglobulin heavy chain variable region protein. Length = 126 Score = 30.3 bits (65), Expect = 8.7 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ APGKGLE++ + + GGST Sbjct: 21 SWVRQAPGKGLEWVSVIYSGGST 43 >DQ073605-1|AAZ52578.1| 118|Homo sapiens immunoglobulin heavy chain variable region protein. Length = 118 Score = 30.3 bits (65), Expect = 8.7 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ +PGKGLE++G + GGST Sbjct: 36 SWVRQSPGKGLEWIGEIYHGGST 58 >AY941915-1|AAY33264.1| 117|Homo sapiens anti-rabies virus immunoglobulin heavy chain variable region protein. Length = 117 Score = 30.3 bits (65), Expect = 8.7 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ APGKGLE++ + + GGST Sbjct: 35 SWVRQAPGKGLEWVSVIYSGGST 57 >AY866650-1|AAW68537.1| 126|Homo sapiens anti-tetanus toxoid immunoglobulin heavy chain variable region protein. Length = 126 Score = 30.3 bits (65), Expect = 8.7 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = -2 Query: 795 PGKGLEFLGMEFPGGS 748 PGKGLE+LGM +PG S Sbjct: 41 PGKGLEWLGMIYPGDS 56 >AY866587-1|AAW68479.1| 126|Homo sapiens anti-tetanus toxoid immunoglobulin heavy chain variable region protein. Length = 126 Score = 30.3 bits (65), Expect = 8.7 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = -2 Query: 795 PGKGLEFLGMEFPGGS 748 PGKGLE+LGM +PG S Sbjct: 41 PGKGLEWLGMIYPGDS 56 >AY686913-1|AAW67383.1| 119|Homo sapiens rotavirus-specific intestinal-homing antibody heavy chain variable region protein. Length = 119 Score = 30.3 bits (65), Expect = 8.7 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ APGKGLE++ + + GGST Sbjct: 37 SWVRQAPGKGLEWVSVIYSGGST 59 >AY686909-1|AAW67381.1| 122|Homo sapiens rotavirus-specific intestinal-homing antibody heavy chain variable region protein. Length = 122 Score = 30.3 bits (65), Expect = 8.7 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ APGKGLE++ + + GGST Sbjct: 37 SWVRQAPGKGLEWVSVIYSGGST 59 >AY640504-1|AAT65109.1| 129|Homo sapiens immunoglobulin E variable region protein. Length = 129 Score = 30.3 bits (65), Expect = 8.7 Identities = 12/22 (54%), Positives = 17/22 (77%), Gaps = 1/22 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGS 748 +W+ PGKGLE++GM +PG S Sbjct: 35 AWVRQTPGKGLEWMGMIYPGDS 56 >AY607550-1|AAT02146.1| 117|Homo sapiens immunoglobulin heavy chain CDR3 protein. Length = 117 Score = 30.3 bits (65), Expect = 8.7 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ APGKGLE++ + + GGST Sbjct: 31 SWVRQAPGKGLEWVSVIYSGGST 53 >AY607504-1|AAT02106.1| 111|Homo sapiens immunoglobulin heavy chain CDR3 protein. Length = 111 Score = 30.3 bits (65), Expect = 8.7 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ APGKGLE++ + + GGST Sbjct: 22 SWVRQAPGKGLEWVSVIYSGGST 44 >AY607454-1|AAT02064.1| 112|Homo sapiens immunoglobulin heavy chain CDR3 protein. Length = 112 Score = 30.3 bits (65), Expect = 8.7 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ APGKGLE++ + + GGST Sbjct: 29 SWVRQAPGKGLEWVSVIYSGGST 51 >AY582434-1|AAT12230.1| 97|Homo sapiens immunoglobulin heavy chain variable region protein. Length = 97 Score = 30.3 bits (65), Expect = 8.7 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ APGKGLE++ + + GGST Sbjct: 14 SWVRQAPGKGLEWVSVIYSGGST 36 >AY582407-1|AAT12208.1| 105|Homo sapiens immunoglobulin heavy chain variable region protein. Length = 105 Score = 30.3 bits (65), Expect = 8.7 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ APGKGLE++ + + GGST Sbjct: 23 SWVRQAPGKGLEWVSVIYSGGST 45 >AY530316-1|AAS19424.1| 116|Homo sapiens anti-SARS S protein immunoglobulin heavy chain variable region protein. Length = 116 Score = 30.3 bits (65), Expect = 8.7 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ APGKGLE++ + + GGST Sbjct: 35 SWVRQAPGKGLEWVSVIYSGGST 57 >AY530312-1|AAS19420.1| 116|Homo sapiens anti-SARS S protein immunoglobulin heavy chain variable region protein. Length = 116 Score = 30.3 bits (65), Expect = 8.7 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ APGKGLE++ + + GGST Sbjct: 35 SWVRQAPGKGLEWVSVIYSGGST 57 >AY430000-1|AAR38750.1| 84|Homo sapiens immunoglobulin heavy chain variable region protein. Length = 84 Score = 30.3 bits (65), Expect = 8.7 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ APGKGLE++ + + GGST Sbjct: 8 SWVRQAPGKGLEWVSVIYSGGST 30 >AY429916-1|AAR38675.1| 92|Homo sapiens immunoglobulin heavy chain variable region protein. Length = 92 Score = 30.3 bits (65), Expect = 8.7 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ APGKGLE++ + + GGST Sbjct: 18 SWVRQAPGKGLEWVSVIYSGGST 40 >AY429865-1|AAR38632.1| 82|Homo sapiens immunoglobulin heavy chain variable region protein. Length = 82 Score = 30.3 bits (65), Expect = 8.7 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ APGKGLE++ + + GGST Sbjct: 8 SWVRQAPGKGLEWVSVIYSGGST 30 >AY062306-1|AAL65734.1| 123|Homo sapiens immunoglobulin heavy chain variable region protein. Length = 123 Score = 30.3 bits (65), Expect = 8.7 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ APGKGLE++ + + GGST Sbjct: 31 SWVRQAPGKGLEWVSVIYSGGST 53 >AY003838-1|AAK11805.1| 113|Homo sapiens immunoglobulin heavy chain variable region protein. Length = 113 Score = 30.3 bits (65), Expect = 8.7 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ APGKGLE++ + + GGST Sbjct: 13 SWVRQAPGKGLEWVSVIYSGGST 35 >AY003830-1|AAK11799.1| 105|Homo sapiens immunoglobulin heavy chain variable region protein. Length = 105 Score = 30.3 bits (65), Expect = 8.7 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ APGKGLE++ + + GGST Sbjct: 7 SWVRQAPGKGLEWVSVIYSGGST 29 >AM079408-1|CAL03554.1| 100|Homo sapiens immunoglobulin heavy chain variable region protein. Length = 100 Score = 30.3 bits (65), Expect = 8.7 Identities = 14/23 (60%), Positives = 17/23 (73%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ APGKGLE++ F GGST Sbjct: 38 SWVRQAPGKGLEWVSSIFGGGST 60 >AM050923-1|CAJ19460.1| 96|Homo sapiens immunoglobulin heavy chain variable region protein. Length = 96 Score = 30.3 bits (65), Expect = 8.7 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ APGKGLE++ + + GGST Sbjct: 20 SWVRQAPGKGLEWVSVIYSGGST 42 >AJ627947-1|CAF31293.1| 123|Homo sapiens immunoglobulin heavy chain variable region protein. Length = 123 Score = 30.3 bits (65), Expect = 8.7 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ APGKGLE++ + + GGST Sbjct: 35 SWVRQAPGKGLEWVSVIYSGGST 57 >AJ551003-1|CAD82927.1| 88|Homo sapiens immunoglobulin heavy chain protein. Length = 88 Score = 30.3 bits (65), Expect = 8.7 Identities = 13/24 (54%), Positives = 17/24 (70%), Gaps = 1/24 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGSTK 742 +W+ PGKGLE++G F GSTK Sbjct: 3 TWIRQPPGKGLEWIGYIFSSGSTK 26 >AJ548507-1|CAD68159.1| 145|Homo sapiens immunoglobulin heavy chain variable region protein. Length = 145 Score = 30.3 bits (65), Expect = 8.7 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ APGKGLE++ + + GGST Sbjct: 54 SWVRQAPGKGLEWVSVIYSGGST 76 >AJ536051-1|CAD59941.1| 120|Homo sapiens immunoglobulin heavy chain variable region protein. Length = 120 Score = 30.3 bits (65), Expect = 8.7 Identities = 12/23 (52%), Positives = 17/23 (73%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 +W+ PGKGLE++G +P GST Sbjct: 37 TWIRQPPGKGLEWIGYIYPSGST 59 >AJ402509-1|CAC15796.1| 84|Homo sapiens immunoglobulin heavy chain variable region protein. Length = 84 Score = 30.3 bits (65), Expect = 8.7 Identities = 12/22 (54%), Positives = 18/22 (81%), Gaps = 1/22 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGS 748 SW+ APGKGLE++ + +PGG+ Sbjct: 5 SWVRQAPGKGLEWVSVIYPGGT 26 >AJ402504-1|CAC15791.1| 86|Homo sapiens immunoglobulin heavy chain variable region protein. Length = 86 Score = 30.3 bits (65), Expect = 8.7 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ APGKGLE++ + + GGST Sbjct: 5 SWVRQAPGKGLEWVSVIYSGGST 27 >AJ402373-1|CAC15660.1| 73|Homo sapiens immunoglobulin heavy chain variable region protein. Length = 73 Score = 30.3 bits (65), Expect = 8.7 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ APGKGLE++ + + GGST Sbjct: 5 SWVRQAPGKGLEWVSVIYSGGST 27 >AJ347251-1|CAC87198.1| 79|Homo sapiens immunoglobulin heavy chain variable region protein. Length = 79 Score = 30.3 bits (65), Expect = 8.7 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ APGKGLE++ + + GGST Sbjct: 1 SWVRQAPGKGLEWVSVIYSGGST 23 >AJ347247-1|CAC87194.1| 83|Homo sapiens immunoglobulin heavy chain variable region protein. Length = 83 Score = 30.3 bits (65), Expect = 8.7 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ APGKGLE++ + + GGST Sbjct: 4 SWVRQAPGKGLEWVSVIYSGGST 26 >AJ275461-1|CAB87546.1| 79|Homo sapiens immunoglobulin heavy chain variable region protein. Length = 79 Score = 30.3 bits (65), Expect = 8.7 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ APGKGLE++ + + GGST Sbjct: 2 SWVRQAPGKGLEWVSVIYSGGST 24 >AJ275393-1|CAB87478.1| 83|Homo sapiens immunoglobulin heavy chain variable region protein. Length = 83 Score = 30.3 bits (65), Expect = 8.7 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ APGKGLE++ + + GGST Sbjct: 12 SWVRQAPGKGLEWVSVIYSGGST 34 >AF297160-1|AAG37211.1| 84|Homo sapiens immunoglobulin heavy chain variable region protein. Length = 84 Score = 30.3 bits (65), Expect = 8.7 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ APGKGLE++ + + GGST Sbjct: 12 SWVRQAPGKGLEWVSVIYSGGST 34 >AF174059-1|AAD53805.1| 126|Homo sapiens immunoglobulin heavy chain variable region protein. Length = 126 Score = 30.3 bits (65), Expect = 8.7 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ APGKGLE++ + + GGST Sbjct: 35 SWVRQAPGKGLEWVSVIYSGGST 57 >AF077468-1|AAC70825.1| 96|Homo sapiens immunoglobulin heavy chain variable region protein. Length = 96 Score = 30.3 bits (65), Expect = 8.7 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ APGKGLE++ + + GGST Sbjct: 24 SWVRQAPGKGLEWVSVIYSGGST 46 >AF077431-1|AAC70793.1| 94|Homo sapiens immunoglobulin heavy chain variable region protein. Length = 94 Score = 30.3 bits (65), Expect = 8.7 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ APGKGLE++ + + GGST Sbjct: 23 SWVRQAPGKGLEWVSVIYSGGST 45 >AF062235-1|AAC18271.1| 123|Homo sapiens immunoglobulin heavy chain variable region protein. Length = 123 Score = 30.3 bits (65), Expect = 8.7 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ APGKGLE++ + + GGST Sbjct: 35 SWVRQAPGKGLEWVSVIYSGGST 57 >AF062229-1|AAC18265.1| 120|Homo sapiens immunoglobulin heavy chain variable region protein. Length = 120 Score = 30.3 bits (65), Expect = 8.7 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ APGKGLE++ + + GGST Sbjct: 26 SWVRQAPGKGLEWVSVIYSGGST 48 >AF062227-1|AAC18263.1| 137|Homo sapiens immunoglobulin heavy chain variable region protein. Length = 137 Score = 30.3 bits (65), Expect = 8.7 Identities = 13/23 (56%), Positives = 17/23 (73%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ +PGKGLE++G P GST Sbjct: 54 SWIRQSPGKGLEWIGEIHPSGST 76 >AF062154-1|AAC18190.1| 138|Homo sapiens immunoglobulin heavy chain variable region protein. Length = 138 Score = 30.3 bits (65), Expect = 8.7 Identities = 12/22 (54%), Positives = 17/22 (77%), Gaps = 1/22 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGS 748 +W+ PGKGLE++G+ FPG S Sbjct: 54 AWVRQMPGKGLEWMGITFPGDS 75 >AF039297-1|AAB96673.1| 123|Homo sapiens anti-dsDNA IgM heavy chain variable region protein. Length = 123 Score = 30.3 bits (65), Expect = 8.7 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ APGKGLE++ + + GGST Sbjct: 35 SWVRQAPGKGLEWVSVIYSGGST 57 >AF035788-1|AAB88520.1| 94|Homo sapiens rheumatoid factor RF-IP8 protein. Length = 94 Score = 30.3 bits (65), Expect = 8.7 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ APGKGLE++ + + GGST Sbjct: 32 SWVRQAPGKGLEWVSVIYSGGST 54 >AF035787-1|AAB88519.1| 94|Homo sapiens rheumatoid factor RF-IP4 protein. Length = 94 Score = 30.3 bits (65), Expect = 8.7 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ APGKGLE++ + + GGST Sbjct: 32 SWVRQAPGKGLEWVSVIYSGGST 54 >AF017464-1|AAB81257.1| 72|Homo sapiens rearranged immunoglobulin heavy chain variable region protein. Length = 72 Score = 30.3 bits (65), Expect = 8.7 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ APGKGLE++ + + GGST Sbjct: 11 SWVRQAPGKGLEWVSVIYSGGST 33 >AF006525-1|AAB62920.1| 128|Homo sapiens immunoglobulin heavy chain variable region protein. Length = 128 Score = 30.3 bits (65), Expect = 8.7 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ APGKGLE++ + + GGST Sbjct: 35 SWVRQAPGKGLEWVSVIYSGGST 57 >AB019438-9|BAA75029.1| 116|Homo sapiens immunogloblin heavy chain variable region protein. Length = 116 Score = 30.3 bits (65), Expect = 8.7 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ APGKGLE++ + + GGST Sbjct: 54 SWVRQAPGKGLEWVSVIYSGGST 76 >AB001736-1|BAA19943.1| 253|Homo sapiens scFv collagenase IV antibody protein. Length = 253 Score = 30.3 bits (65), Expect = 8.7 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ APGKGLE++ + + GGST Sbjct: 36 SWVRQAPGKGLEWVSVIYSGGST 58 >AB001733-1|BAA19453.1| 253|Homo sapiens single-chain antibody protein. Length = 253 Score = 30.3 bits (65), Expect = 8.7 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -2 Query: 810 SWL-SAPGKGLEFLGMEFPGGST 745 SW+ APGKGLE++ + + GGST Sbjct: 36 SWVRQAPGKGLEWVSVIYSGGST 58 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 113,765,711 Number of Sequences: 237096 Number of extensions: 2230723 Number of successful extensions: 16663 Number of sequences better than 10.0: 138 Number of HSP's better than 10.0 without gapping: 16216 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16659 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 10092110758 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -