BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30578 (796 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_23860| Best HMM Match : Defensin_3 (HMM E-Value=3.3) 30 2.5 SB_40295| Best HMM Match : HALZ (HMM E-Value=0.25) 29 5.7 >SB_23860| Best HMM Match : Defensin_3 (HMM E-Value=3.3) Length = 242 Score = 29.9 bits (64), Expect = 2.5 Identities = 13/43 (30%), Positives = 22/43 (51%) Frame = +1 Query: 166 GSRKSLALQPVLIMHPHAPMDMDTYSHYSGGPRDPNTECTRTL 294 GS + +++ L+ HPH P T S SG P + C +++ Sbjct: 156 GSLEQISISKQLVNHPHHPRATKTDSRGSGHPEKGSRGCKQSI 198 >SB_40295| Best HMM Match : HALZ (HMM E-Value=0.25) Length = 477 Score = 28.7 bits (61), Expect = 5.7 Identities = 25/92 (27%), Positives = 40/92 (43%), Gaps = 6/92 (6%) Frame = +1 Query: 124 EVNNGYVTDATSVSG----SRKSLALQPVLIMHPHAPMDMDTYSHYSGGPRDPNTECTRT 291 E+N G VTD ++ S L+ ++ H P+D+ + PR N T Sbjct: 24 ELNPGPVTDNNNIEDICLYSNGDFTLRYRMLRHGLTPLDVGRGVNIL--PRLQNQTATIK 81 Query: 292 LCI--IINYNSTVKRLKIRPSIVFTAARWHCT 381 + + ++ Y S+ L +RP V AA W T Sbjct: 82 VDLKRMLKYKSSALSLNVRPYKVLQAANWLIT 113 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,994,603 Number of Sequences: 59808 Number of extensions: 394167 Number of successful extensions: 726 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 677 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 725 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2191792647 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -