BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30578 (796 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC113964-1|AAI13965.1| 232|Homo sapiens LOC375323 protein protein. 31 3.6 AY278320-1|AAP37013.1| 247|Homo sapiens lipoma HMGIC fusion par... 31 3.6 >BC113964-1|AAI13965.1| 232|Homo sapiens LOC375323 protein protein. Length = 232 Score = 31.5 bits (68), Expect = 3.6 Identities = 19/56 (33%), Positives = 26/56 (46%) Frame = +1 Query: 1 ILAAIGCLDGAVLSALAFILATRHVRLRPDAGYPPPSLYKGEVNNGYVTDATSVSG 168 ILA IG L+ +LS LAF+L R L + P + G + + VSG Sbjct: 163 ILAIIGILNALILSFLAFVLGNRQTDLLQEELKPENKDFVGSTVSSVLRPGGDVSG 218 >AY278320-1|AAP37013.1| 247|Homo sapiens lipoma HMGIC fusion partner-like protein 4 protein. Length = 247 Score = 31.5 bits (68), Expect = 3.6 Identities = 19/56 (33%), Positives = 26/56 (46%) Frame = +1 Query: 1 ILAAIGCLDGAVLSALAFILATRHVRLRPDAGYPPPSLYKGEVNNGYVTDATSVSG 168 ILA IG L+ +LS LAF+L R L + P + G + + VSG Sbjct: 178 ILAIIGILNALILSFLAFVLGNRQTDLLQEELKPENKDFVGSTVSSVLRPGGDVSG 233 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 98,122,960 Number of Sequences: 237096 Number of extensions: 1864032 Number of successful extensions: 7843 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7770 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7843 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 9757565650 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -