BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30578 (796 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g56860.1 68418.m07095 zinc finger (GATA type) family protein ... 29 4.7 At1g78110.1 68414.m09103 expressed protein 28 8.2 >At5g56860.1 68418.m07095 zinc finger (GATA type) family protein similar to unknown protein (pir |T04270) Length = 398 Score = 28.7 bits (61), Expect = 4.7 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = -2 Query: 783 FPLNFKVNFTITHPEDLSVKSI 718 +PLN K NF H EDL+ K++ Sbjct: 179 YPLNHKTNFDEDHHEDLNFKNV 200 >At1g78110.1 68414.m09103 expressed protein Length = 342 Score = 27.9 bits (59), Expect = 8.2 Identities = 15/40 (37%), Positives = 18/40 (45%) Frame = +1 Query: 118 KGEVNNGYVTDATSVSGSRKSLALQPVLIMHPHAPMDMDT 237 +G ++GY D SR LAL P I P P D T Sbjct: 9 RGSSSSGYSADLLVCFPSRTHLALTPKPICSPSRPSDSST 48 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,394,862 Number of Sequences: 28952 Number of extensions: 265980 Number of successful extensions: 504 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 492 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 504 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1794809600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -