BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30577 (811 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory recept... 25 0.94 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 6.6 EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggeri... 21 8.8 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 21 8.8 >AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory receptor candidate 48 protein. Length = 408 Score = 24.6 bits (51), Expect = 0.94 Identities = 18/61 (29%), Positives = 26/61 (42%) Frame = -3 Query: 242 AVRNLKLNKYYQSKYVFNTIIAIKIIENPIGKYDRTYYFFSEFLYFCNYVIGSLLFFGCI 63 + ++K KY + F I + I I K Y F + YF V+ LL GCI Sbjct: 13 STHSMKNFKYLKVLVTFAHFICLFPITINIRKNGLNYNFTKK-CYFLRMVLIDLLIVGCI 71 Query: 62 I 60 + Sbjct: 72 L 72 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.8 bits (44), Expect = 6.6 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +1 Query: 529 YRICINSININWKV 570 Y IC N I WKV Sbjct: 2105 YEICTNVIKKGWKV 2118 >EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggering hormone receptorisoform A protein. Length = 434 Score = 21.4 bits (43), Expect = 8.8 Identities = 9/29 (31%), Positives = 15/29 (51%) Frame = -3 Query: 239 VRNLKLNKYYQSKYVFNTIIAIKIIENPI 153 V +L++ KYY Y ++ + NPI Sbjct: 321 VYHLEIEKYYNILYFCRIMVYLNSAINPI 349 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 21.4 bits (43), Expect = 8.8 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +1 Query: 460 NVLVLSLYLLRCSFSLY 510 NVL+ +YL C F +Y Sbjct: 1126 NVLLNCVYLFLCGFCVY 1142 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 183,420 Number of Sequences: 336 Number of extensions: 4151 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 22102797 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -