BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30577 (811 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_29064| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_36782| Best HMM Match : Pkinase (HMM E-Value=1.4e-32) 28 7.8 >SB_29064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 324 Score = 29.5 bits (63), Expect = 3.4 Identities = 12/38 (31%), Positives = 19/38 (50%) Frame = +1 Query: 502 SLYLAPRNIYRICINSININWKVAPFIKMALGNPFQED 615 ++Y PR +Y N + + P I AL PFQ++ Sbjct: 269 TMYTVPRQVYLATTNLAGFSSCINPIIYAALSRPFQQE 306 >SB_36782| Best HMM Match : Pkinase (HMM E-Value=1.4e-32) Length = 310 Score = 28.3 bits (60), Expect = 7.8 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -3 Query: 500 KEHLNKYKLKTSTFLKDRKVNQILF 426 +E LN +K + STF K R N +LF Sbjct: 51 EEQLNAFKFQVSTFRKTRHDNTVLF 75 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,895,675 Number of Sequences: 59808 Number of extensions: 422454 Number of successful extensions: 942 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 874 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 941 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2251677692 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -