BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30577 (811 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U97007-2|AAB52298.2| 271|Caenorhabditis elegans Hypothetical pr... 28 6.9 U00058-1|AAL02529.2| 241|Caenorhabditis elegans Hypothetical pr... 28 6.9 >U97007-2|AAB52298.2| 271|Caenorhabditis elegans Hypothetical protein ZC196.8 protein. Length = 271 Score = 28.3 bits (60), Expect = 6.9 Identities = 18/66 (27%), Positives = 29/66 (43%) Frame = -3 Query: 206 SKYVFNTIIAIKIIENPIGKYDRTYYFFSEFLYFCNYVIGSLLFFGCIIY*LWA*TYFAG 27 S N A+ + + + + +YFFS + FC+Y S+LF +I A +F Sbjct: 20 SNLFINIPAALSLFSKEVTQ-SQLFYFFSYLIDFCHY---SILFSNLVISIQRAFVFFLR 75 Query: 26 YWERYF 9 W F Sbjct: 76 NWTNQF 81 >U00058-1|AAL02529.2| 241|Caenorhabditis elegans Hypothetical protein W03A5.2 protein. Length = 241 Score = 28.3 bits (60), Expect = 6.9 Identities = 20/61 (32%), Positives = 33/61 (54%), Gaps = 5/61 (8%) Frame = +1 Query: 466 LVLSLY----LLRCSFSLYLAPRNIYRICINSININWKVAPFIK-MALGNPFQEDSIP*V 630 L++SLY LL C F+ Y+ +N Y I N I + V ++K L + F++ +I + Sbjct: 11 LLISLYSIICLLVCDFTKYIPAKNAYTIMTNHILLLLSVWMYLKYRELKSFFRQANISII 70 Query: 631 F 633 F Sbjct: 71 F 71 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,274,509 Number of Sequences: 27780 Number of extensions: 364930 Number of successful extensions: 868 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 851 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 868 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1987863822 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -