BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30577 (811 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated... 24 1.9 EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase p... 23 3.3 AF205594-1|AAQ13840.1| 156|Apis mellifera acid phosphatase prec... 23 4.4 >DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 510 Score = 23.8 bits (49), Expect = 1.9 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = -3 Query: 446 KVNQILFCYKYLHRNACYFFTYVVLSTEFE 357 KV +I+F + N CY+ YV EF+ Sbjct: 470 KVARIVFPASFGLLNICYWVIYVTYQEEFK 499 >EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase protein. Length = 620 Score = 23.0 bits (47), Expect = 3.3 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -3 Query: 161 NPIGKYDRTYYFFSEFLYFCNYVIGSLL 78 N +G +F E +YF + V+GSLL Sbjct: 443 NVLGVQGALLSYFIEPIYFHSIVLGSLL 470 >AF205594-1|AAQ13840.1| 156|Apis mellifera acid phosphatase precursor protein. Length = 156 Score = 22.6 bits (46), Expect = 4.4 Identities = 12/31 (38%), Positives = 18/31 (58%), Gaps = 2/31 (6%) Frame = -3 Query: 215 YYQSKYVFN--TIIAIKIIENPIGKYDRTYY 129 Y+ S F TI K++E+P GKY+ + Y Sbjct: 26 YFNSLVRFRRFTIELDKVLESPRGKYEFSKY 56 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 216,644 Number of Sequences: 438 Number of extensions: 4727 Number of successful extensions: 9 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25731924 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -