BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30575 (705 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_01_0657 + 5322295-5323367,5323436-5323555,5323743-5323791,532... 28 6.3 >11_01_0657 + 5322295-5323367,5323436-5323555,5323743-5323791, 5323968-5324084,5324200-5324268,5324394-5324488, 5325183-5325521,5327043-5327084,5327814-5327907, 5328121-5328190,5328719-5329677 Length = 1008 Score = 28.3 bits (60), Expect = 6.3 Identities = 16/41 (39%), Positives = 20/41 (48%) Frame = +2 Query: 32 LFKQNDTQASPFQLNISQQNMDTNTFQKSNTQQSFFGKNVP 154 L KQN A+ QLN+ QQ Q+ QQ KN+P Sbjct: 260 LTKQNPQAAAAAQLNLLQQQRILQMQQQQQQQQQQILKNLP 300 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,742,353 Number of Sequences: 37544 Number of extensions: 336576 Number of successful extensions: 630 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 623 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 630 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1815633512 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -