BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30575 (705 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_42867| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_14971| Best HMM Match : CHGN (HMM E-Value=0.0084) 28 6.4 >SB_42867| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 870 Score = 29.5 bits (63), Expect = 2.8 Identities = 14/59 (23%), Positives = 24/59 (40%) Frame = +3 Query: 33 CLNRMTLKLHHFN*ISRSKIWILIPSKSQIHNNHFLEKMCLQ*NRVVFIVKWKSSHQTI 209 CL R +HH + + L P + +H+ + + +CL + W H TI Sbjct: 587 CLCRYVASVHHVYVVMSPVVPCLCPYVASVHHVYVIMSLCLCLTGCAVLESWAGIHWTI 645 >SB_14971| Best HMM Match : CHGN (HMM E-Value=0.0084) Length = 598 Score = 28.3 bits (60), Expect = 6.4 Identities = 15/34 (44%), Positives = 18/34 (52%) Frame = +1 Query: 370 PCTGRSHPTYLGCEVVMYSSLKDKILVMLQLRLR 471 P TGR H TY + V KD I+ +L L LR Sbjct: 401 PLTGRFHKTYAIQKAVSSVRDKDSIVFLLDLHLR 434 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,399,291 Number of Sequences: 59808 Number of extensions: 426906 Number of successful extensions: 659 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 613 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 659 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1853669818 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -