BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30575 (705 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/p... 23 9.4 AY062207-1|AAL58568.1| 504|Anopheles gambiae cytochrome P450 CY... 23 9.4 AJ439060-1|CAD27752.1| 763|Anopheles gambiae hypothetical prote... 23 9.4 AJ438610-9|CAD27481.1| 763|Anopheles gambiae hypothetical prote... 23 9.4 AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 23 9.4 >AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/proton exchanger 3 protein. Length = 1221 Score = 23.0 bits (47), Expect = 9.4 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = -1 Query: 135 NDCCVFDFWKVLVSIFCCEIFN*NGEA*VSFCLNKF 28 N+ V++ W VL++I C ++ G +S N+F Sbjct: 550 NNKHVWNTWFVLLTIIFCSVYRILGVLILSALANRF 585 >AY062207-1|AAL58568.1| 504|Anopheles gambiae cytochrome P450 CYP6S2 protein. Length = 504 Score = 23.0 bits (47), Expect = 9.4 Identities = 12/38 (31%), Positives = 16/38 (42%) Frame = +2 Query: 29 NLFKQNDTQASPFQLNISQQNMDTNTFQKSNTQQSFFG 142 NL Q+D P L + + TF K+N FG Sbjct: 398 NLAFQHDPTLFPDPLAFKPERFEDKTFAKTNPSYLAFG 435 >AJ439060-1|CAD27752.1| 763|Anopheles gambiae hypothetical protein protein. Length = 763 Score = 23.0 bits (47), Expect = 9.4 Identities = 10/25 (40%), Positives = 17/25 (68%) Frame = +1 Query: 409 EVVMYSSLKDKILVMLQLRLRPHVS 483 EV++ ++K +IL L LR RP ++ Sbjct: 383 EVILLQTIKHQILHKLGLRERPRLT 407 >AJ438610-9|CAD27481.1| 763|Anopheles gambiae hypothetical protein protein. Length = 763 Score = 23.0 bits (47), Expect = 9.4 Identities = 10/25 (40%), Positives = 17/25 (68%) Frame = +1 Query: 409 EVVMYSSLKDKILVMLQLRLRPHVS 483 EV++ ++K +IL L LR RP ++ Sbjct: 383 EVILLQTIKHQILHKLGLRERPRLT 407 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 23.0 bits (47), Expect = 9.4 Identities = 11/27 (40%), Positives = 16/27 (59%), Gaps = 1/27 (3%) Frame = +2 Query: 191 ELTPDDLEAFKSDKFQLGFVP-E*HHP 268 ++ PD LE F + K GF+ + HHP Sbjct: 351 KIDPDRLEVFSTVKEITGFINIQAHHP 377 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 741,543 Number of Sequences: 2352 Number of extensions: 14783 Number of successful extensions: 24 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71922660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -