BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30575 (705 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z77657-5|CAB01145.2| 381|Caenorhabditis elegans Hypothetical pr... 30 1.9 AF039048-13|AAB94231.1| 440|Caenorhabditis elegans Hypothetical... 28 7.5 AL132860-4|CAB60496.1| 762|Caenorhabditis elegans Hypothetical ... 27 9.9 >Z77657-5|CAB01145.2| 381|Caenorhabditis elegans Hypothetical protein F08H9.8 protein. Length = 381 Score = 29.9 bits (64), Expect = 1.9 Identities = 15/35 (42%), Positives = 22/35 (62%) Frame = +3 Query: 390 PYLFRL*SSYVL*FEG*DTGYATVET*ASCLKLDY 494 PYL YVL ++G DT Y ++ + +S LKL+Y Sbjct: 204 PYLVEGYVDYVLIYDGPDTTYPSLGSTSSALKLEY 238 >AF039048-13|AAB94231.1| 440|Caenorhabditis elegans Hypothetical protein F16B4.11 protein. Length = 440 Score = 27.9 bits (59), Expect = 7.5 Identities = 15/53 (28%), Positives = 26/53 (49%) Frame = +2 Query: 56 ASPFQLNISQQNMDTNTFQKSNTQQSFFGKNVPSVEQSGVYSKMEELTPDDLE 214 +S +LN ++D + F K + +Q + + V SKM E+ P D+E Sbjct: 289 SSDTKLNFGNVHIDLSCFSKYSFEQMRYFFSPNEVYYDEAISKMVEMQPSDIE 341 >AL132860-4|CAB60496.1| 762|Caenorhabditis elegans Hypothetical protein Y56A3A.5 protein. Length = 762 Score = 27.5 bits (58), Expect = 9.9 Identities = 16/44 (36%), Positives = 25/44 (56%), Gaps = 7/44 (15%) Frame = +3 Query: 102 IPSKSQIHNNHFLEKMCLQ*NRVVF-------IVKWKSSHQTIW 212 +P+ QI E+MCL+ R+V +++WKS +QTIW Sbjct: 699 MPNSVQIVALPNQEEMCLKVMRIVEEISEGVQVLRWKSENQTIW 742 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,090,441 Number of Sequences: 27780 Number of extensions: 328231 Number of successful extensions: 783 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 768 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 783 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1634564590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -