BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30575 (705 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 24 1.6 Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP... 22 4.9 DQ011227-1|AAY63896.1| 484|Apis mellifera Amt-1-like protein pr... 22 6.5 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 22 6.5 DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated... 21 8.6 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 23.8 bits (49), Expect = 1.6 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +3 Query: 615 IDSQWHIYYHFKDHLDLNT 671 IDS H+Y K LD+NT Sbjct: 995 IDSNLHVYAPLKISLDVNT 1013 >Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP57-1 protein. Length = 544 Score = 22.2 bits (45), Expect = 4.9 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = +2 Query: 23 NQNLFKQNDTQASPFQLNISQQNMDTNTFQKSN 121 NQN KQN + + + N ++QN + K N Sbjct: 449 NQNANKQNGNRQNDNRQNDNKQNGNRQNDNKQN 481 >DQ011227-1|AAY63896.1| 484|Apis mellifera Amt-1-like protein protein. Length = 484 Score = 21.8 bits (44), Expect = 6.5 Identities = 7/16 (43%), Positives = 12/16 (75%) Frame = +1 Query: 481 SNWIITFTLLVYVLIT 528 SNWIIT + +++ + T Sbjct: 31 SNWIITNSFIIFTMQT 46 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 21.8 bits (44), Expect = 6.5 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -3 Query: 352 SSLLEFWKYSLMSTHNVVYTRFNCY 278 SSL +KYS + +N Y +N Y Sbjct: 316 SSLSNNYKYSNYNNYNNNYNNYNNY 340 >DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 510 Score = 21.4 bits (43), Expect = 8.6 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = +1 Query: 106 LPKVKYTTIIFW 141 LPKV+Y T + W Sbjct: 298 LPKVRYATALDW 309 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 199,041 Number of Sequences: 438 Number of extensions: 4171 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21683070 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -