BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30572 (725 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_46389| Best HMM Match : No HMM Matches (HMM E-Value=.) 128 5e-30 SB_52883| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.72 SB_19195| Best HMM Match : LEA_4 (HMM E-Value=0.00053) 30 1.7 SB_3451| Best HMM Match : HOK_GEF (HMM E-Value=9.4) 29 2.9 SB_30928| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_52974| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 >SB_46389| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 128 bits (309), Expect = 5e-30 Identities = 54/70 (77%), Positives = 66/70 (94%) Frame = +2 Query: 44 MGAYRYIQELYRKKLSDVMRFLLRVRVWQYRQLTRMHRAPRPTRPDKARRLGYRAKQGYV 223 MGAY+Y++ELY+KK SD++RFLLRVR WQYRQLT +HRA RPTRPDKARRLGY+AKQG+V Sbjct: 1 MGAYKYLEELYKKKQSDLLRFLLRVRCWQYRQLTAIHRATRPTRPDKARRLGYKAKQGFV 60 Query: 224 VFRIRVRRGG 253 ++R+RVRRGG Sbjct: 61 IYRVRVRRGG 70 Score = 110 bits (264), Expect = 1e-24 Identities = 51/80 (63%), Positives = 59/80 (73%) Frame = +1 Query: 256 KRPVAKGATYGKPKSHGVNQLKPTRNLQSIAEEXXXXXXXXXXXXSSYWVAQDSSYKYFE 435 KRPV KGATYGKP + GVN+LK R+L+S+AEE +SYWV QDS YKYFE Sbjct: 72 KRPVPKGATYGKPVNQGVNELKFQRSLRSVAEERAGRYCGGLRVLNSYWVGQDSIYKYFE 131 Query: 436 VILVDPSHKAIRRDPKINWI 495 VI+VDP HKAIRRD +INWI Sbjct: 132 VIMVDPFHKAIRRDARINWI 151 Score = 54.4 bits (125), Expect = 9e-08 Identities = 22/36 (61%), Positives = 28/36 (77%) Frame = +3 Query: 510 KHREMRGLTSAGRSSRGLGKGHRYSQTKGGSRRAAW 617 KHRE+RGLT+AG +RG+ KGH Y++ G SRRA W Sbjct: 157 KHRELRGLTAAGTKNRGMRKGHNYNKVIGSSRRANW 192 >SB_52883| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1434 Score = 31.5 bits (68), Expect = 0.72 Identities = 18/58 (31%), Positives = 27/58 (46%), Gaps = 1/58 (1%) Frame = +1 Query: 133 PSVDSYAPRSQAHKAGQSPKT-RLPC*TRLCCIQNPCATWWPKRPVAKGATYGKPKSH 303 P D+ AH+ P T ++PC C QNPC+ P + +TYG P+ + Sbjct: 239 PKTDANGGMQIAHQLPYPPYTGQIPCLPSSCAPQNPCS---PPGCTPQYSTYGYPQGY 293 >SB_19195| Best HMM Match : LEA_4 (HMM E-Value=0.00053) Length = 1152 Score = 30.3 bits (65), Expect = 1.7 Identities = 24/80 (30%), Positives = 36/80 (45%), Gaps = 5/80 (6%) Frame = +1 Query: 91 RCYAFFVA---CEGMA-VPSVDSYAPRSQAHKAGQSPKT-RLPC*TRLCCIQNPCATWWP 255 RCY VA C ++ P +D+ A + P T ++PC C QNPC+ P Sbjct: 702 RCYDINVAGINCRIISHPPKIDTTGGMQMAQQLSYPPYTGQVPCLPSSCTPQNPCS---P 758 Query: 256 KRPVAKGATYGKPKSHGVNQ 315 + +T G P++ G Q Sbjct: 759 PGCTPQYSTSGYPQAPGYPQ 778 >SB_3451| Best HMM Match : HOK_GEF (HMM E-Value=9.4) Length = 173 Score = 29.5 bits (63), Expect = 2.9 Identities = 16/64 (25%), Positives = 33/64 (51%) Frame = +2 Query: 101 RFLLRVRVWQYRQLTRMHRAPRPTRPDKARRLGYRAKQGYVVFRIRVRRGGPSVQLLRVP 280 +F ++ YR+ T+MH +RP + R G+R KQ ++ + + +L+ V Sbjct: 16 KFFVKRLTTPYRRRTQMHLLVSTSRPASSWRRGFRGKQMWLTQLLELTSLNGYFELVLVF 75 Query: 281 LMAS 292 +++S Sbjct: 76 ILSS 79 >SB_30928| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 282 Score = 29.1 bits (62), Expect = 3.8 Identities = 14/45 (31%), Positives = 20/45 (44%) Frame = +3 Query: 204 VLNKVMLYSESVCDVVAQASSC*GCHLWQAQEPWCQPVEAHAQPS 338 V+N +L V + V Q C CH AQ+ W V+ + S Sbjct: 121 VMNSTILQQVFVVEYVVQGQMCDACHRQAAQDFWKAVVQVRQKTS 165 >SB_52974| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 660 Score = 28.3 bits (60), Expect = 6.7 Identities = 18/66 (27%), Positives = 30/66 (45%) Frame = +2 Query: 26 LPQAAKMGAYRYIQELYRKKLSDVMRFLLRVRVWQYRQLTRMHRAPRPTRPDKARRLGYR 205 LP A +G Y + ++ +R + + +R + +RV+ Y T T D A G Sbjct: 474 LPDNANLGCYPWSKQTFRHEGPNHIRTSVHIRVYAYIMSTTQQSKITKTITDAAVITGLV 533 Query: 206 AKQGYV 223 A G+V Sbjct: 534 AGIGWV 539 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,575,889 Number of Sequences: 59808 Number of extensions: 536869 Number of successful extensions: 1236 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1114 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1236 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1937927537 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -