BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30569 (649 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_44740| Best HMM Match : GTP_EFTU (HMM E-Value=0) 140 7e-34 SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_35448| Best HMM Match : GTP_EFTU (HMM E-Value=1.6e-10) 34 0.087 SB_50050| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_18076| Best HMM Match : GTP_EFTU (HMM E-Value=0.018) 33 0.26 SB_40813| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_3698| Best HMM Match : GTP_EFTU (HMM E-Value=9.3e-34) 31 0.61 SB_7329| Best HMM Match : GTP_EFTU (HMM E-Value=0) 31 0.61 SB_42973| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_36714| Best HMM Match : RBM1CTR (HMM E-Value=0.72) 29 4.3 SB_18656| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_11602| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_50728| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_35209| Best HMM Match : Ank (HMM E-Value=0) 28 5.7 SB_23513| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_6320| Best HMM Match : Exo_endo_phos (HMM E-Value=4.8) 27 9.9 >SB_44740| Best HMM Match : GTP_EFTU (HMM E-Value=0) Length = 833 Score = 140 bits (340), Expect = 7e-34 Identities = 67/73 (91%), Positives = 70/73 (95%) Frame = +1 Query: 37 VNFTVDEIRGMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRK 216 VNFT D+IRG+MDKK NIRNMSVIAHVDHGKSTLTDSLVSKAGIIA A+AGETRFTDTRK Sbjct: 1 VNFTTDQIRGIMDKKLNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAAAKAGETRFTDTRK 60 Query: 217 DEQDRCITIKSTA 255 DEQDRCITIKSTA Sbjct: 61 DEQDRCITIKSTA 73 Score = 116 bits (278), Expect = 2e-26 Identities = 62/112 (55%), Positives = 75/112 (66%) Frame = +3 Query: 255 ISMFFELEEKDLVFITNPDQREKSEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXX 434 IS+++EL E D +IT P ++ E+GFLINLIDSPGHVDFSSEVTAALRVTDGAL Sbjct: 74 ISLYYELPESDFEYITQP--KDPKERGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVD 131 Query: 435 XXXXXXXQTETVLRQAIAERIKPILS*TKWTVLFLSSNLKLKNYTRTFPGVL 590 QTETVLRQAIAERIKP+L K L L ++ +TF ++ Sbjct: 132 CVSGVCVQTETVLRQAIAERIKPVLFMNKMDRALLELQLDQEDLYQTFARIV 183 >SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2670 Score = 48.8 bits (111), Expect = 4e-06 Identities = 23/54 (42%), Positives = 36/54 (66%) Frame = +1 Query: 88 IRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDRCITIKS 249 +RN S++AHVDHGKSTL D L+ G I+ + + + D + E++R IT+K+ Sbjct: 1941 VRNFSIVAHVDHGKSTLADRLLEVTGTISKS-SDNKQVLDKLQVERERGITVKA 1993 >SB_35448| Best HMM Match : GTP_EFTU (HMM E-Value=1.6e-10) Length = 563 Score = 34.3 bits (75), Expect = 0.087 Identities = 18/44 (40%), Positives = 24/44 (54%) Frame = +3 Query: 378 SSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAIAERIKPIL 509 + +V+ A+R+ DGAL QT VLRQA E I+P L Sbjct: 21 AGKVSTAVRLCDGALVVVDVVEGVSPQTHVVLRQAWLENIRPCL 64 Score = 34.3 bits (75), Expect = 0.087 Identities = 18/42 (42%), Positives = 23/42 (54%) Frame = +3 Query: 384 EVTAALRVTDGALXXXXXXXXXXXQTETVLRQAIAERIKPIL 509 +V+ A+R+ DGAL QT VLRQA E I+P L Sbjct: 93 QVSTAVRLCDGALVVVDVVEGVSPQTHVVLRQAWLENIRPCL 134 >SB_50050| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 545 Score = 32.7 bits (71), Expect = 0.26 Identities = 14/34 (41%), Positives = 23/34 (67%) Frame = +1 Query: 97 MSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETR 198 ++++ HVDHGK+TL D+L + + AG G T+ Sbjct: 31 VTIMGHVDHGKTTLLDAL-RNSSVAAGEAGGITQ 63 Score = 29.9 bits (64), Expect = 1.9 Identities = 19/67 (28%), Positives = 28/67 (41%) Frame = +3 Query: 321 KSEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAIAERIK 500 K G I ID+PGH F+S VTD + QT +R A+ ++ Sbjct: 71 KLPSGEKITFIDTPGHAAFNSMRARGANVTDIVVLVVAADDGVKTQTVESIRHAMHAKVP 130 Query: 501 PILS*TK 521 I++ K Sbjct: 131 LIVAINK 137 >SB_18076| Best HMM Match : GTP_EFTU (HMM E-Value=0.018) Length = 106 Score = 32.7 bits (71), Expect = 0.26 Identities = 16/32 (50%), Positives = 20/32 (62%) Frame = +1 Query: 70 MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 165 M K++ N+ VI HVD GKST T L+ K G Sbjct: 1 MPKEKIHINIVVIGHVDSGKSTTTGHLIYKCG 32 >SB_40813| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 809 Score = 32.7 bits (71), Expect = 0.26 Identities = 14/61 (22%), Positives = 30/61 (49%) Frame = +1 Query: 34 MVNFTVDEIRGMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTR 213 + N+ ++ + +MD IRN+++ H+ GK+ D L + A+ G+ +T Sbjct: 112 LTNYNIEYLADLMDNPELIRNVALAGHLHSGKTAFLDCLFEQTHPELEAKEGKEVMLNTE 171 Query: 214 K 216 + Sbjct: 172 R 172 >SB_3698| Best HMM Match : GTP_EFTU (HMM E-Value=9.3e-34) Length = 240 Score = 31.5 bits (68), Expect = 0.61 Identities = 14/34 (41%), Positives = 22/34 (64%) Frame = +1 Query: 97 MSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETR 198 ++V+ HVDHGK++L D + A +I G G T+ Sbjct: 94 VTVMGHVDHGKTSLLD-YIRNANVIEGESGGITQ 126 >SB_7329| Best HMM Match : GTP_EFTU (HMM E-Value=0) Length = 359 Score = 31.5 bits (68), Expect = 0.61 Identities = 13/44 (29%), Positives = 21/44 (47%) Frame = +3 Query: 342 INLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVL 473 IN++D+PGH DF+ + L D + QTE ++ Sbjct: 81 INILDTPGHKDFAEDTFRTLTAVDSVIVVIDVAKGVEEQTEKLV 124 Score = 30.7 bits (66), Expect = 1.1 Identities = 15/38 (39%), Positives = 22/38 (57%) Frame = +1 Query: 73 DKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARA 186 D+ + R +I+H D GK+TLT+ L+ G I A A Sbjct: 5 DEIKRRRTFGIISHPDAGKTTLTEKLLLFGGAIQEAGA 42 >SB_42973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1864 Score = 29.1 bits (62), Expect = 3.3 Identities = 19/66 (28%), Positives = 27/66 (40%), Gaps = 3/66 (4%) Frame = -1 Query: 454 THTPDTQSTTTRAPSVTRSAAVTSEEKSTCPGESIKL---IKKPFSLFSRWSGFVMNTKS 284 TH+P + TTT AP+ E C G+ ++L K +L R+ G Sbjct: 612 THSPSSTPTTTGAPTTAGFNEFNLEASEDCTGDYVELRDGDSKSAALIGRYCGTNAPMML 671 Query: 283 FSSSSK 266 SS K Sbjct: 672 MGSSDK 677 >SB_36714| Best HMM Match : RBM1CTR (HMM E-Value=0.72) Length = 300 Score = 28.7 bits (61), Expect = 4.3 Identities = 14/41 (34%), Positives = 20/41 (48%) Frame = -1 Query: 415 PSVTRSAAVTSEEKSTCPGESIKLIKKPFSLFSRWSGFVMN 293 P R A TCPGE ++L+ + +RWS V+N Sbjct: 242 PPPERQALACLRHTHTCPGEQLRLVGQ-LGHRARWSSSVIN 281 >SB_18656| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3292 Score = 28.7 bits (61), Expect = 4.3 Identities = 15/47 (31%), Positives = 22/47 (46%) Frame = -1 Query: 472 STVSVCTHTPDTQSTTTRAPSVTRSAAVTSEEKSTCPGESIKLIKKP 332 ST+ T + STTT A ++ TS + E+ + IKKP Sbjct: 2817 STIGTSRPTSEAFSTTTAATGTIPDSSATSATEGLSDAETEEFIKKP 2863 >SB_11602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 440 Score = 28.7 bits (61), Expect = 4.3 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = -1 Query: 454 THTPDTQSTTTRAPSVTRSAAVTSEEKST 368 T TP+TQSTTT P T+S T E +ST Sbjct: 346 TETPETQSTTT-TPE-TQSTTTTPETQST 372 Score = 27.5 bits (58), Expect = 9.9 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = -1 Query: 454 THTPDTQSTTTRAPSVTRSAAVTSEEKST 368 T TP+TQSTTT P T+S T E +ST Sbjct: 391 TETPETQSTTT-TPE-TQSTTGTPETQST 417 >SB_50728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 28.3 bits (60), Expect = 5.7 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = +2 Query: 416 SPCGC*LCVWCVCTNR 463 SPC C+WC C+ R Sbjct: 18 SPCALYFCIWCECSKR 33 >SB_35209| Best HMM Match : Ank (HMM E-Value=0) Length = 787 Score = 28.3 bits (60), Expect = 5.7 Identities = 12/22 (54%), Positives = 16/22 (72%) Frame = +1 Query: 211 RKDEQDRCITIKSTASLCSSSL 276 R +EQD C + +T +LCSSSL Sbjct: 733 RSNEQDFCGIVYNTTNLCSSSL 754 >SB_23513| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 340 Score = 27.9 bits (59), Expect = 7.5 Identities = 16/53 (30%), Positives = 28/53 (52%), Gaps = 1/53 (1%) Frame = +1 Query: 127 KSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDRC-ITIKSTASLCSSSLKR 282 K+ + D+LV GI+ R G +TD + +R + + SL +++LKR Sbjct: 182 KTLIKDNLVGPKGIVVDPRTGLMFWTDKETPKIERATLAGRDRISLVTTALKR 234 >SB_6320| Best HMM Match : Exo_endo_phos (HMM E-Value=4.8) Length = 845 Score = 27.5 bits (58), Expect = 9.9 Identities = 16/60 (26%), Positives = 30/60 (50%) Frame = -1 Query: 553 FKLELKKSTVHFVHERIGLMRSAIA*RSTVSVCTHTPDTQSTTTRAPSVTRSAAVTSEEK 374 ++L+LK S + F RIG+ +S ++S+ H P T T ++ +T+E + Sbjct: 66 YRLQLKTS-LGFCRSRIGIQKSTKHGSYSLSIPGHDPPTDITIFLGVAINPGPMLTTERE 124 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,374,434 Number of Sequences: 59808 Number of extensions: 416923 Number of successful extensions: 1392 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 1150 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1380 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1645141000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -