BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30568 (723 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_06_0233 + 21565233-21566053,21566840-21567890,21568075-215687... 33 0.30 01_01_0596 + 4435643-4436664,4437241-4437766 33 0.30 07_01_1203 - 11464142-11464324,11464422-11464484,11464685-114665... 31 1.2 11_06_0226 + 21461174-21462018,21462508-21464439,21464746-21464845 30 1.6 05_01_0418 - 3288844-3288990,3289256-3289332,3289578-3289653,329... 30 2.1 05_06_0043 + 25143513-25143866,25144010-25144191,25144284-251443... 28 6.5 02_05_0624 - 30451032-30451140,30451294-30451409,30451506-304515... 28 8.6 >11_06_0233 + 21565233-21566053,21566840-21567890,21568075-21568758, 21568927-21569019,21571815-21571835 Length = 889 Score = 32.7 bits (71), Expect = 0.30 Identities = 18/60 (30%), Positives = 30/60 (50%), Gaps = 3/60 (5%) Frame = +2 Query: 335 FEGNELGNCQTGLTTVYRVKADQCDR---LWVLDVGTYGYDNVTNVCPYTLNVFDLNTDQ 505 F EL + Q L V +V+ DQ D+ +W DV YD N+ + L++ D+ ++ Sbjct: 35 FLKTELESIQAALEKVSKVQLDQLDKQIKIWARDVRELSYDIEDNIDTFMLHINDIEPNK 94 >01_01_0596 + 4435643-4436664,4437241-4437766 Length = 515 Score = 32.7 bits (71), Expect = 0.30 Identities = 21/69 (30%), Positives = 33/69 (47%), Gaps = 4/69 (5%) Frame = +2 Query: 290 DAPY--EPSPKLTPYPSFEGNELGNCQTGLTTVYRVKADQCDR--LWVLDVGTYGYDNVT 457 DAP +P L YP G ++ + RVK D+ +W+LD GT+ ++ V Sbjct: 205 DAPQVNDPYHNLIHYPHQHGKLNCLVESPAGDLMRVKRQSNDKFVVWILDKGTFSWEKVD 264 Query: 458 NVCPYTLNV 484 N+ + L V Sbjct: 265 NIGDFALFV 273 >07_01_1203 - 11464142-11464324,11464422-11464484,11464685-11466515, 11467240-11468036 Length = 957 Score = 30.7 bits (66), Expect = 1.2 Identities = 19/57 (33%), Positives = 28/57 (49%), Gaps = 3/57 (5%) Frame = +2 Query: 332 SFEGNELGNCQTGLTTVYRVKADQCD---RLWVLDVGTYGYDNVTNVCPYTLNVFDL 493 +F +EL + Q + + +V DQ D ++W DV YD NV + L V DL Sbjct: 27 TFLNSELESMQAEVDKISKVPLDQLDSQIKIWARDVRELSYDIEDNVDTFMLCVDDL 83 >11_06_0226 + 21461174-21462018,21462508-21464439,21464746-21464845 Length = 958 Score = 30.3 bits (65), Expect = 1.6 Identities = 20/66 (30%), Positives = 28/66 (42%), Gaps = 3/66 (4%) Frame = +2 Query: 347 ELGNCQTGLTTVYRVKADQCD---RLWVLDVGTYGYDNVTNVCPYTLNVFDLNTDQISVN 517 EL + Q L V +V DQ D ++W D+ YD N+ + L V L + Sbjct: 48 ELKSIQAALEKVSKVPLDQLDEQTKIWAWDIRELSYDMEDNIDTFMLRVDGLEPAKKHNF 107 Query: 518 TCYDQK 535 TC K Sbjct: 108 TCLVDK 113 >05_01_0418 - 3288844-3288990,3289256-3289332,3289578-3289653, 3290125-3290220,3290307-3290376,3290474-3290564, 3290753-3290822,3290908-3291044,3291313-3291465, 3291816-3291864,3292205-3292366 Length = 375 Score = 29.9 bits (64), Expect = 2.1 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = +1 Query: 181 YQRTHCPLVSKGGGTNCSSAFLGGARYPSYFELHSTGRSI*TIP 312 +Q T P + G T+C AF+GG Y Y GR + IP Sbjct: 295 FQSTTFPGAATSGVTDCQQAFIGGIAYGGYAR-KIVGRVLRKIP 337 >05_06_0043 + 25143513-25143866,25144010-25144191,25144284-25144374, 25144452-25144568,25144922-25144976,25145008-25145093, 25145190-25145300,25145564-25145608,25145695-25145740, 25146078-25146152,25146902-25146971,25147128-25147437, 25147778-25147851,25147996-25148151,25148416-25148539 Length = 631 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = +2 Query: 146 LEAAGSQDWCSDTRERTARWYRKVEEQI 229 +E S+ CS+T E+ RWY + +E++ Sbjct: 246 IETIRSEFSCSETCEKLQRWYGETDEEV 273 >02_05_0624 - 30451032-30451140,30451294-30451409,30451506-30451580, 30452033-30452093,30452198-30452424 Length = 195 Score = 27.9 bits (59), Expect = 8.6 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = +3 Query: 117 VVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNK 227 +VD DQ K +R I E+ P G ++WRNK Sbjct: 146 LVDELLSDQHLKNYRMRKVREIQESRTPGGSQKWRNK 182 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,903,540 Number of Sequences: 37544 Number of extensions: 475132 Number of successful extensions: 1250 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1171 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1250 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1886372480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -