BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30567 (719 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ288392-1|ABC41342.1| 120|Apis mellifera nanos protein. 26 0.41 AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precur... 23 3.8 DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated... 22 5.1 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 22 6.7 AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. 22 6.7 AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cycl... 21 8.9 >DQ288392-1|ABC41342.1| 120|Apis mellifera nanos protein. Length = 120 Score = 25.8 bits (54), Expect = 0.41 Identities = 10/33 (30%), Positives = 13/33 (39%) Frame = +3 Query: 351 PSCYNCNKTGHIARNCPEGGRESATQTCYNCNK 449 P C C H + CP+G + T N K Sbjct: 76 PICGACGDIAHTVKYCPKGTKNPGTLATVNAFK 108 Score = 22.6 bits (46), Expect = 3.8 Identities = 8/19 (42%), Positives = 9/19 (47%) Frame = +3 Query: 432 CYNCNKSGHISRNCPDGTK 488 C C H + CP GTK Sbjct: 78 CGACGDIAHTVKYCPKGTK 96 >AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precursor protein. Length = 405 Score = 22.6 bits (46), Expect = 3.8 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = -2 Query: 712 SRNLNSSSLWRGRRFCNLYCKSV 644 ++N N+ SL + F N YC ++ Sbjct: 92 NKNCNAGSLTVKKNFANKYCGNI 114 >DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 391 Score = 22.2 bits (45), Expect = 5.1 Identities = 7/24 (29%), Positives = 14/24 (58%) Frame = +1 Query: 100 EFSKPIAMSSSVCYKCNRTGHFAR 171 + KP+ +V Y ++G+F+R Sbjct: 165 DIGKPVVAEETVDYMLEKSGNFSR 188 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 21.8 bits (44), Expect = 6.7 Identities = 9/25 (36%), Positives = 12/25 (48%) Frame = -3 Query: 480 RRDSCGRCGRTCCSYSRSASQTPAP 406 R +S G CGR ++ S P P Sbjct: 40 RSESSGYCGRRPSTFGSSNEALPQP 64 >AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. Length = 289 Score = 21.8 bits (44), Expect = 6.7 Identities = 9/25 (36%), Positives = 12/25 (48%) Frame = -3 Query: 480 RRDSCGRCGRTCCSYSRSASQTPAP 406 R +S G CGR ++ S P P Sbjct: 40 RSESSGYCGRRPSTFGSSNEALPQP 64 >AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cyclase alpha 1 subunit protein. Length = 699 Score = 21.4 bits (43), Expect = 8.9 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = -3 Query: 270 NPSQSACAVALEALLT 223 NPS AVAL ALL+ Sbjct: 78 NPSNEVVAVALGALLS 93 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 187,934 Number of Sequences: 438 Number of extensions: 3882 Number of successful extensions: 13 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22292145 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -