BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30565 (576 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF441189-1|AAL73401.1| 134|Apis mellifera ribosomal protein 49 ... 25 0.54 AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisp... 24 0.94 DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride... 23 1.6 DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride... 23 1.6 DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride... 23 1.6 DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride... 23 1.6 DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly pro... 22 5.0 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 21 6.6 DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channe... 21 8.7 DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related pro... 21 8.7 >AF441189-1|AAL73401.1| 134|Apis mellifera ribosomal protein 49 protein. Length = 134 Score = 25.0 bits (52), Expect = 0.54 Identities = 13/35 (37%), Positives = 22/35 (62%) Frame = +1 Query: 184 IGHNPDAKRTRVKLPSGAKKVLPSATEAWSVLLLE 288 IG+ + K+TR LP+G +KVL + VL+++ Sbjct: 57 IGYGSN-KKTRHMLPTGFRKVLVHNVKELEVLMMQ 90 >AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform B protein. Length = 463 Score = 24.2 bits (50), Expect = 0.94 Identities = 13/37 (35%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = -2 Query: 551 KFRSPSLYRSC-LHESSGPASSNKTNFATSRCSSLDS 444 K +L+ S LHES G + N R S+DS Sbjct: 47 KIEKQNLHESDDLHESDGRVGGKRRNILLRRTDSMDS 83 >DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride channel variant 4 protein. Length = 489 Score = 23.4 bits (48), Expect = 1.6 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -1 Query: 135 HFLFKIAHNGTLRHSSNRHHI 73 HF +I NGT+ + RH I Sbjct: 163 HFALRIYRNGTVNYLMRRHLI 183 >DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride channel variant 3 protein. Length = 475 Score = 23.4 bits (48), Expect = 1.6 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -1 Query: 135 HFLFKIAHNGTLRHSSNRHHI 73 HF +I NGT+ + RH I Sbjct: 163 HFALRIYRNGTVNYLMRRHLI 183 >DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride channel variant 1 protein. Length = 509 Score = 23.4 bits (48), Expect = 1.6 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -1 Query: 135 HFLFKIAHNGTLRHSSNRHHI 73 HF +I NGT+ + RH I Sbjct: 214 HFALRIYRNGTVNYLMRRHLI 234 >DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride channel protein. Length = 458 Score = 23.4 bits (48), Expect = 1.6 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -1 Query: 135 HFLFKIAHNGTLRHSSNRHHI 73 HF +I NGT+ + RH I Sbjct: 163 HFALRIYRNGTVNYLMRRHLI 183 >DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly protein 9 protein. Length = 423 Score = 21.8 bits (44), Expect = 5.0 Identities = 9/28 (32%), Positives = 17/28 (60%) Frame = +3 Query: 480 GLIAARRTGRFVEARPIQRRRPKFIIKS 563 GL++ G + E RP++RR + + K+ Sbjct: 317 GLVSDTALGCWNENRPLKRRNIEIVAKN 344 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 21.4 bits (43), Expect = 6.6 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -2 Query: 539 PSLYRSCLHESSGPASSNKT 480 PS+ RS +HE S A S+++ Sbjct: 59 PSIDRSSIHEESYLAESSRS 78 >DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channel protein. Length = 489 Score = 21.0 bits (42), Expect = 8.7 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = -2 Query: 443 GSLTYMLMVTTTVRMLYRVH 384 GS+TY + TTT+ + +H Sbjct: 147 GSVTYGMRFTTTLACMMDLH 166 >DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related protein STG-1 protein. Length = 397 Score = 21.0 bits (42), Expect = 8.7 Identities = 5/14 (35%), Positives = 10/14 (71%) Frame = +2 Query: 341 QGQT*LLAICTWCC 382 +G+ +++ C WCC Sbjct: 3 KGRHVVMSCCCWCC 16 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 178,082 Number of Sequences: 438 Number of extensions: 4296 Number of successful extensions: 14 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16626408 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -