BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30564 (479 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_55959| Best HMM Match : No HMM Matches (HMM E-Value=.) 139 9e-34 SB_11738| Best HMM Match : SH3_2 (HMM E-Value=3.7e-32) 30 1.1 SB_9375| Best HMM Match : Sec6 (HMM E-Value=0.35) 28 3.5 SB_31673| Best HMM Match : rve (HMM E-Value=6.7e-30) 27 6.1 SB_41095| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.0 SB_40712| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.0 SB_37931| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.0 >SB_55959| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 139 bits (337), Expect = 9e-34 Identities = 64/77 (83%), Positives = 71/77 (92%) Frame = +1 Query: 220 SQETEAACKGPSRMPTKILRITTRKTPCGEGSKTWDRFQMRIHKRVIDLHSPSEIVKQIT 399 ++E + KGP RMPTK LRITTRKTPCGEGSKTWDR++MRIHKR+IDLHSPSEIVKQIT Sbjct: 24 AKEKKLKVKGPVRMPTKFLRITTRKTPCGEGSKTWDRYEMRIHKRLIDLHSPSEIVKQIT 83 Query: 400 SINIEPGVEVEVTIADA 450 SI+IEPGVEVEVTIADA Sbjct: 84 SISIEPGVEVEVTIADA 100 Score = 37.9 bits (84), Expect = 0.004 Identities = 18/29 (62%), Positives = 23/29 (79%), Gaps = 2/29 (6%) Frame = +2 Query: 173 RNVRSLEKV--CADLINGAKKQKLRVKGP 253 + VR+ KV CADLI GAK++KL+VKGP Sbjct: 6 KKVRTTRKVTVCADLIRGAKEKKLKVKGP 34 >SB_11738| Best HMM Match : SH3_2 (HMM E-Value=3.7e-32) Length = 2436 Score = 29.9 bits (64), Expect = 1.1 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = +2 Query: 107 KDIEKPQAEVSPIHRIRITLTSRNVRSLEKVCAD 208 + + K Q E + IH + +T ++VRSLE+ C + Sbjct: 663 RQLHKIQEESTRIHHLAVTALEKDVRSLEQRCLE 696 >SB_9375| Best HMM Match : Sec6 (HMM E-Value=0.35) Length = 1049 Score = 28.3 bits (60), Expect = 3.5 Identities = 19/47 (40%), Positives = 22/47 (46%) Frame = -3 Query: 471 FYWRLCLRVGDGHLNLYTGLDVN*GDLFHNFRGRV*VDHSLVDSHLK 331 FY L L V D L G+D DLF R VD+SLV +K Sbjct: 405 FYSNLVLEVSDNETELVNGIDQLWDDLFVESRR---VDYSLVSVKMK 448 >SB_31673| Best HMM Match : rve (HMM E-Value=6.7e-30) Length = 426 Score = 27.5 bits (58), Expect = 6.1 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = -2 Query: 340 ASENDPRSLNLHHKEFYGW*YAGSWLACGWALYTQL 233 ASENDP ++H+ Y G W C A YT++ Sbjct: 151 ASENDPELQSVHYYISY-----GDWSQCKLAAYTRI 181 >SB_41095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 561 Score = 27.1 bits (57), Expect = 8.0 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = -2 Query: 478 KNILLAALPTRRRWSPQP 425 +N+++ LPT +RW P P Sbjct: 180 RNVVIQRLPTSQRWQPYP 197 >SB_40712| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 27.1 bits (57), Expect = 8.0 Identities = 14/44 (31%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = +1 Query: 256 RMPTKILRITT-RKTPCGEGSKTWDRFQMRIHKRVIDLHSPSEI 384 R+PT + T +K PC TW R + KR + +H P+ + Sbjct: 22 RVPTAFPSVATGKKYPCQRKKVTWSR-KKNPFKRRVPVHVPTSL 64 >SB_37931| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 361 Score = 27.1 bits (57), Expect = 8.0 Identities = 14/41 (34%), Positives = 24/41 (58%) Frame = +2 Query: 74 TSNMAAAVVSGKDIEKPQAEVSPIHRIRITLTSRNVRSLEK 196 T N A+ ++S + +PQA + P+H I + SRN ++ K Sbjct: 306 TLNSASVILS---LAEPQAGILPVHPHSIEIASRNRDAIAK 343 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,097,387 Number of Sequences: 59808 Number of extensions: 327644 Number of successful extensions: 695 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 662 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 695 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1001731762 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -