BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30560 (710 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF025462-3|AAB71002.1| 309|Caenorhabditis elegans Hypothetical ... 29 3.3 Z27078-5|CAE54900.1| 96|Caenorhabditis elegans Hypothetical pr... 28 5.7 >AF025462-3|AAB71002.1| 309|Caenorhabditis elegans Hypothetical protein K10F12.4a protein. Length = 309 Score = 29.1 bits (62), Expect = 3.3 Identities = 17/51 (33%), Positives = 25/51 (49%), Gaps = 3/51 (5%) Frame = +2 Query: 113 LASSRTAMRTTFYVSRRNSF---VLWKMLERRGASILSMVSLSRVNPGSHH 256 L +S +R TFY R+ + ++W LER +S S R PG H+ Sbjct: 225 LRNSENLLRDTFYGGRQPGYADYLMWPFLERLQLLTMSPNSQFRYFPGLHY 275 >Z27078-5|CAE54900.1| 96|Caenorhabditis elegans Hypothetical protein K04H4.7 protein. Length = 96 Score = 28.3 bits (60), Expect = 5.7 Identities = 19/60 (31%), Positives = 28/60 (46%) Frame = +1 Query: 37 NMKFYILIALFALACAERDSTLETAISFVQDCNEDYFLCVKEKLLRIVENARTSRSVNLV 216 N Y+L+A L CA ++ E +I DC ED V L+ E ++R NL+ Sbjct: 4 NSMIYLLVAFLVLLCATTEAKKECSI----DCQEDGSAAVDLGLVLPPELYESTRLSNLL 59 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,385,205 Number of Sequences: 27780 Number of extensions: 277515 Number of successful extensions: 739 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 697 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 739 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1655655746 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -