BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30559 (704 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_47652| Best HMM Match : Ribosomal_L10e (HMM E-Value=0.0041) 84 1e-16 SB_21942| Best HMM Match : C4dic_mal_tran (HMM E-Value=0.053) 33 0.30 SB_58466| Best HMM Match : DUF624 (HMM E-Value=2.1) 32 0.52 SB_28115| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_4321| Best HMM Match : Ank (HMM E-Value=0) 29 3.7 SB_7933| Best HMM Match : GCC2_GCC3 (HMM E-Value=1.4e-18) 29 4.9 SB_33920| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 SB_25504| Best HMM Match : 7tm_1 (HMM E-Value=2.3e-07) 28 6.4 SB_6123| Best HMM Match : MutS_III (HMM E-Value=1.8e-09) 28 6.4 SB_37809| Best HMM Match : NADH5_C (HMM E-Value=3) 28 6.4 SB_25165| Best HMM Match : Prominin (HMM E-Value=1.1e-05) 28 8.5 SB_14136| Best HMM Match : Exonuc_X-T (HMM E-Value=6e-25) 28 8.5 >SB_47652| Best HMM Match : Ribosomal_L10e (HMM E-Value=0.0041) Length = 50 Score = 83.8 bits (198), Expect = 1e-16 Identities = 40/50 (80%), Positives = 43/50 (86%) Frame = +3 Query: 354 MRGAFGKPQGTVARVRIGQPIMSVRSSDRWKAQVIEALRRAKFKFPGRQK 503 MRGAFGKPQGTVARV IGQ I+S+R+ D KA IEALRRAKFKFPGRQK Sbjct: 1 MRGAFGKPQGTVARVNIGQTIISIRTKDGNKAAAIEALRRAKFKFPGRQK 50 >SB_21942| Best HMM Match : C4dic_mal_tran (HMM E-Value=0.053) Length = 659 Score = 32.7 bits (71), Expect = 0.30 Identities = 23/67 (34%), Positives = 30/67 (44%) Frame = -1 Query: 590 VIGEGGPLHAASQTHHVHTL*NPTSLILDLLTSGELELGTAQSLDDLCLPPVTRAHGHDG 411 V+ GG L Q H + NP++ L+ LE TA + V A+ DG Sbjct: 23 VMHPGGRLPVKRQLHLISAPVNPSTRFTPTLSRMSLETVTAAPIPTQTSRSVALAY--DG 80 Query: 410 LSNANTC 390 LSNAN C Sbjct: 81 LSNANVC 87 >SB_58466| Best HMM Match : DUF624 (HMM E-Value=2.1) Length = 174 Score = 31.9 bits (69), Expect = 0.52 Identities = 14/51 (27%), Positives = 26/51 (50%) Frame = -2 Query: 670 LRISALKPSFQSVREVHVPGGTARCKPSLAKAALFTQLLKLITFILCETPL 518 L + ++ +S +H+PG + + ++A L L+ F+LC TPL Sbjct: 52 LNFAIIRKLVRSQEAIHIPGAQQQKRARRFRSATRIVLSSLLLFVLCATPL 102 >SB_28115| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 698 Score = 29.5 bits (63), Expect = 2.8 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = -2 Query: 208 PKPLSSAVHIRRTPSARTVESRQRSLSSYPNRRYGSWDQ 92 PK SS V+ RT AR ++R++ Y ++YG W Q Sbjct: 295 PKFFSSIVYYGRT--ARFDYGKRRNMKRYGKKKYGKWRQ 331 >SB_4321| Best HMM Match : Ank (HMM E-Value=0) Length = 915 Score = 29.1 bits (62), Expect = 3.7 Identities = 17/62 (27%), Positives = 26/62 (41%) Frame = +1 Query: 40 RYCKNKPYPKSRFCRGVPDPKIRIFDLGKKRANVDDFPLCVHLVSDEYEQLSSEALEAGR 219 R CK K ++R C+G + R+ K D+ +C SDE E + R Sbjct: 444 RMCKGKGRDETRMCKGEGTDETRMC----KSEGTDETRMCKDEGSDETRMCKDEGTDETR 499 Query: 220 IC 225 +C Sbjct: 500 MC 501 >SB_7933| Best HMM Match : GCC2_GCC3 (HMM E-Value=1.4e-18) Length = 1023 Score = 28.7 bits (61), Expect = 4.9 Identities = 16/47 (34%), Positives = 19/47 (40%) Frame = -3 Query: 405 QCEHVLQYPEACQTHHASQSGAYQLQRTITFY*CG*RGKGEVSCGYG 265 +C V Q P AC + S GA + Y C K V CG G Sbjct: 535 KCPDVTQAPVACTNGYYSGDGATECTLCPAGYSCADATKSPVPCGKG 581 >SB_33920| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1278 Score = 28.3 bits (60), Expect = 6.4 Identities = 15/49 (30%), Positives = 24/49 (48%), Gaps = 2/49 (4%) Frame = -1 Query: 497 TSGELELGTAQSLDDLCLPPVTRAHGHDGLSNANT--CYSTLRLAKRTT 357 ++G + T D+C+P + HGH +ANT CY + A +T Sbjct: 73 SAGHYVVRTGNPFTDICIP--CQCHGHSDQCDANTGICYVRIYTADLST 119 >SB_25504| Best HMM Match : 7tm_1 (HMM E-Value=2.3e-07) Length = 326 Score = 28.3 bits (60), Expect = 6.4 Identities = 14/51 (27%), Positives = 24/51 (47%) Frame = -2 Query: 670 LRISALKPSFQSVREVHVPGGTARCKPSLAKAALFTQLLKLITFILCETPL 518 L S + +S +H+P + + ++A L L+ F+LC TPL Sbjct: 214 LNFSIILKLVRSQEAIHIPEAQQQKRARRFRSATRMVLSSLLLFVLCATPL 264 >SB_6123| Best HMM Match : MutS_III (HMM E-Value=1.8e-09) Length = 730 Score = 28.3 bits (60), Expect = 6.4 Identities = 14/49 (28%), Positives = 25/49 (51%) Frame = -1 Query: 311 IDADNVERVKSHADMELILPQFFTRYLLQQIRPASKASELSCSYSSDTK 165 + A+ V+R+ SH M+ + + Y +PA+K + L C Y+ K Sbjct: 16 LTAERVQRLLSHTRMKEV-SRICKVYFSSDTKPAAKTNNLLCQYNEIKK 63 >SB_37809| Best HMM Match : NADH5_C (HMM E-Value=3) Length = 1165 Score = 28.3 bits (60), Expect = 6.4 Identities = 18/56 (32%), Positives = 27/56 (48%) Frame = -2 Query: 682 SDYTLRISALKPSFQSVREVHVPGGTARCKPSLAKAALFTQLLKLITFILCETPLL 515 SD L + P F R V++ GT S + +L + ++ L+TF E PLL Sbjct: 127 SDDFLPFVQVPPDFS--RPVNLGSGTQVVLKSTGEQSLLSSIMSLVTFSPAEPPLL 180 >SB_25165| Best HMM Match : Prominin (HMM E-Value=1.1e-05) Length = 726 Score = 27.9 bits (59), Expect = 8.5 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = +2 Query: 362 CVWQASGYCSTCSHWTTHHV 421 C W +G C C HW HV Sbjct: 79 CYWIRTGCCHLCWHWRPLHV 98 >SB_14136| Best HMM Match : Exonuc_X-T (HMM E-Value=6e-25) Length = 1597 Score = 27.9 bits (59), Expect = 8.5 Identities = 13/43 (30%), Positives = 25/43 (58%) Frame = -3 Query: 180 FVGHQVHAQWKVVNVRSLLTQIEDTDLGIRYTPTEPRFRIRFI 52 FVGH + ++V+N+ Q+ DT +G+ + P + +RF+ Sbjct: 465 FVGHGLKKDFRVINILVPKGQVFDT-VGLFHLPRQRYLSLRFL 506 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,288,091 Number of Sequences: 59808 Number of extensions: 536848 Number of successful extensions: 1847 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 1660 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1844 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1853669818 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -