BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30559 (704 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ441131-8|CAD29637.1| 756|Anopheles gambiae putative 5-oxoprol... 26 1.3 AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprol... 23 7.1 AF080564-1|AAC31944.1| 372|Anopheles gambiae Sex combs reduced ... 23 7.1 U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse tra... 23 9.4 AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 23 9.4 AJ302661-1|CAC35526.1| 128|Anopheles gambiae gSG8 protein protein. 23 9.4 >AJ441131-8|CAD29637.1| 756|Anopheles gambiae putative 5-oxoprolinase protein. Length = 756 Score = 25.8 bits (54), Expect = 1.3 Identities = 14/41 (34%), Positives = 18/41 (43%) Frame = +1 Query: 175 DEYEQLSSEALEAGRICCNKYLVKNCGRISSISA*DFTLST 297 D Y LE RI + V+ CGR S + DF +T Sbjct: 590 DRYRSEFGFVLEGRRILVDDIRVRGCGRASLFTEPDFAEAT 630 >AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprolinase protein. Length = 1344 Score = 23.4 bits (48), Expect = 7.1 Identities = 13/41 (31%), Positives = 17/41 (41%) Frame = +1 Query: 175 DEYEQLSSEALEAGRICCNKYLVKNCGRISSISA*DFTLST 297 D Y LE RI + V+ CGR S + D +T Sbjct: 634 DRYRSEFGFVLEGRRILVDDIRVRGCGRASLFTEPDIAEAT 674 >AF080564-1|AAC31944.1| 372|Anopheles gambiae Sex combs reduced homeotic protein protein. Length = 372 Score = 23.4 bits (48), Expect = 7.1 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = -1 Query: 272 DMELILPQFFTRYLLQQIRPASKASELSCSYSSDTKCT 159 D + PQ F L QQ +P S + SC Y+S+ T Sbjct: 100 DYTQLQPQKFL--LSQQQQPQSALTSQSCKYASEGPST 135 >U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse transcriptase protein. Length = 1049 Score = 23.0 bits (47), Expect = 9.4 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = -1 Query: 182 YSSDTKCTHSGKSSTF 135 Y+S TK TH+ KS T+ Sbjct: 474 YNSKTKSTHTPKSITY 489 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 23.0 bits (47), Expect = 9.4 Identities = 10/27 (37%), Positives = 13/27 (48%) Frame = -1 Query: 629 RGPCSGRYCTMQAVIGEGGPLHAASQT 549 + P S R ++G GPLH A T Sbjct: 174 QAPSSDRPAQRTRILGLAGPLHGAGCT 200 >AJ302661-1|CAC35526.1| 128|Anopheles gambiae gSG8 protein protein. Length = 128 Score = 23.0 bits (47), Expect = 9.4 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +1 Query: 613 PEHGPLERFGRKVSGLR 663 P ER GRKV+GLR Sbjct: 75 PNRTVQERLGRKVAGLR 91 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 806,697 Number of Sequences: 2352 Number of extensions: 17486 Number of successful extensions: 30 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 30 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71922660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -