BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30555 (707 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC17A5.15c |||glutamate-tRNA ligase |Schizosaccharomyces pombe... 27 2.0 SPAC29B12.07 |sec16||multidomain vesicle coat component Sec16|Sc... 26 4.6 >SPAC17A5.15c |||glutamate-tRNA ligase |Schizosaccharomyces pombe|chr 1|||Manual Length = 716 Score = 27.5 bits (58), Expect = 2.0 Identities = 13/36 (36%), Positives = 18/36 (50%), Gaps = 1/36 (2%) Frame = +3 Query: 219 PIRQSCRCRPGRKV-EEYDAHPQYSFAYDVQDSLTG 323 P+ C P + +Y A+P Y FA + DSL G Sbjct: 363 PVIYRCNLLPHHRTGTKYRAYPTYDFACPIVDSLEG 398 >SPAC29B12.07 |sec16||multidomain vesicle coat component Sec16|Schizosaccharomyces pombe|chr 1|||Manual Length = 1995 Score = 26.2 bits (55), Expect = 4.6 Identities = 19/59 (32%), Positives = 31/59 (52%), Gaps = 2/59 (3%) Frame = +3 Query: 267 YDAHPQYSFAYDVQDSLTGDSKT--QHETRDGDVVQGSYSVVDPDGTKRTVDYTADPHN 437 Y + QY+ D++D T D T +HE D +V + S+ +GT TV+ T++ N Sbjct: 206 YITNSQYNDTLDMEDQ-TSDLITTFEHENEDHEVHEVP-SIHGMEGTFETVNLTSEAGN 262 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,972,944 Number of Sequences: 5004 Number of extensions: 30894 Number of successful extensions: 85 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 84 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 85 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 329179816 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -