BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30555 (707 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_1138 - 26397585-26398682 28 6.3 01_06_0430 + 29299970-29300031,29300162-29300294,29301057-293011... 28 8.4 >12_02_1138 - 26397585-26398682 Length = 365 Score = 28.3 bits (60), Expect = 6.3 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = -3 Query: 321 QLDCLARRKRSCTEDERRIPRLCDRGD 241 +L CL +RK SC +E P L D D Sbjct: 267 KLPCLTKRKDSCYPEEHYFPTLLDMQD 293 >01_06_0430 + 29299970-29300031,29300162-29300294,29301057-29301160, 29302201-29302372,29302488-29302628,29302707-29303055, 29303133-29305477 Length = 1101 Score = 27.9 bits (59), Expect = 8.4 Identities = 17/56 (30%), Positives = 28/56 (50%), Gaps = 2/56 (3%) Frame = +3 Query: 288 SFAYDVQDSLTG--DSKTQHETRDGDVVQGSYSVVDPDGTKRTVDYTADPHNGFNA 449 S +D Q+ G S + D DV G +++DP +K T + T + H GF++ Sbjct: 558 STIWDSQNDKAGPDSSAVVFDQYDSDV--GEENLLDPFSSKHTEEPTVEDHKGFSS 611 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,617,712 Number of Sequences: 37544 Number of extensions: 245668 Number of successful extensions: 797 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 762 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 797 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1827423340 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -