BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30555 (707 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF531707-1|ABP57431.1| 138|Apis mellifera structural cuticle pr... 27 0.13 AM420631-1|CAM06631.1| 153|Apis mellifera bursicon subunit alph... 25 0.70 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 25 0.93 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 22 6.6 DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated... 21 8.7 >EF531707-1|ABP57431.1| 138|Apis mellifera structural cuticle protein protein. Length = 138 Score = 27.5 bits (58), Expect = 0.13 Identities = 14/28 (50%), Positives = 17/28 (60%) Frame = +3 Query: 360 VVQGSYSVVDPDGTKRTVDYTADPHNGF 443 V QGS S PDG + ++ Y AD NGF Sbjct: 70 VSQGSDSYTAPDGQQVSITYVAD-ENGF 96 >AM420631-1|CAM06631.1| 153|Apis mellifera bursicon subunit alpha protein precursor protein. Length = 153 Score = 25.0 bits (52), Expect = 0.70 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 234 CRCRPGRKVEEYDAHPQ 284 C CRP VEEY PQ Sbjct: 113 CMCRPCTSVEEYAIIPQ 129 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 24.6 bits (51), Expect = 0.93 Identities = 13/52 (25%), Positives = 23/52 (44%) Frame = +3 Query: 357 DVVQGSYSVVDPDGTKRTVDYTADPHNGFNAVVHKEPLAHVAKVAKIAAPLP 512 ++ + S +DP + ++ A H+G V P A V AK+ +P Sbjct: 658 NLASANISQLDPYSSLLSITNLAAEHSGDYTCVAANPAAEVRYTAKLQVKVP 709 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 21.8 bits (44), Expect = 6.6 Identities = 11/38 (28%), Positives = 17/38 (44%) Frame = -2 Query: 184 EQPEQHVPREQLHMRLEQDVRCMPQEQSLLEQSQMRRP 71 +Q QHV Q + +Q + Q+Q +Q Q P Sbjct: 428 QQQTQHVINAQQPQQQQQQQQQQQQQQQQQQQQQQHWP 465 >DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 391 Score = 21.4 bits (43), Expect = 8.7 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +3 Query: 414 DYTADPHNGFNAVVHKEPLAHVAKVAKIAA 503 DY P F+++ +P AKV++IAA Sbjct: 59 DYVTLPPEFFDSLWQPDPYFLNAKVSEIAA 88 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 134,423 Number of Sequences: 438 Number of extensions: 2102 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21804885 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -