BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30554 (378 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_16411| Best HMM Match : DUF791 (HMM E-Value=0) 29 0.95 SB_22062| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 >SB_16411| Best HMM Match : DUF791 (HMM E-Value=0) Length = 445 Score = 29.5 bits (63), Expect = 0.95 Identities = 14/44 (31%), Positives = 26/44 (59%) Frame = +3 Query: 42 NTKVNLLGNLEQVFESVIYVGCFLNYSPIAFRVGLHPSAAILVA 173 N ++ L+G + +FES +Y+ FL ++P+ R +P I+ A Sbjct: 244 NRRIMLIGIINSLFESAMYIFVFL-WTPVLDRHQQYPPLGIVFA 286 >SB_22062| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 275 Score = 26.6 bits (56), Expect = 6.7 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = -3 Query: 328 FYSI*IELKFQFNHYAIIDKLKQNFNYLKLNK 233 F + +E F NHY + + KQ +YLKL++ Sbjct: 142 FQLLCLETSFDKNHYVVGTERKQLASYLKLSE 173 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,606,218 Number of Sequences: 59808 Number of extensions: 210443 Number of successful extensions: 443 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 423 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 442 length of database: 16,821,457 effective HSP length: 74 effective length of database: 12,395,665 effective search space used: 632178915 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -