BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30552 (777 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY695258-1|AAW21975.1| 232|Tribolium castaneum muscle segment h... 24 1.6 AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. 23 2.7 >AY695258-1|AAW21975.1| 232|Tribolium castaneum muscle segment homeodomain protein protein. Length = 232 Score = 23.8 bits (49), Expect = 1.6 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = +3 Query: 687 WPDVSTTASPFNTAPNDPTLVGHLPKKHR 773 W + ++SP +AP P +V +KH+ Sbjct: 85 WGSLXRSSSPQTSAPTGPPIVRCALRKHK 113 >AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. Length = 697 Score = 23.0 bits (47), Expect = 2.7 Identities = 12/37 (32%), Positives = 24/37 (64%) Frame = +1 Query: 484 HGGSKKSRLAKSIGISNFNTTQIDRILENGQIKPSVL 594 HG S + + +G S+ N ++I ++ +NGQIK +++ Sbjct: 537 HGHSFRVVAMERVG-SHVNVSEILKMDQNGQIKRNLV 572 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 188,313 Number of Sequences: 336 Number of extensions: 4255 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20961338 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -