Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30549
         (797 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At3g02710.1 68416.m00262 nuclear associated protein-related / NA...    28   8.3  

>At3g02710.1 68416.m00262 nuclear associated protein-related /
           NAP-related similar to Nuclear associated protein (NAP)
           (NYD-SP19) (Swiss-Prot:Q8WYA6) [Homo sapiens]
          Length = 529

 Score = 27.9 bits (59), Expect = 8.3
 Identities = 12/37 (32%), Positives = 21/37 (56%)
 Frame = +2

Query: 194 CKRIKIVSANLYKVKLEVFSEMKEYLSTYCRIFITNN 304
           C+R K++   L K+K+  F  +K+Y S    I + N+
Sbjct: 209 CERTKLLRWLLTKIKVREFEGIKQYASEILAILLQNS 245


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,996,700
Number of Sequences: 28952
Number of extensions: 321294
Number of successful extensions: 596
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 580
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 596
length of database: 12,070,560
effective HSP length: 80
effective length of database: 9,754,400
effective search space used: 1804564000
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)