BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30548 (818 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-sign... 25 2.1 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 25 2.8 AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. 24 6.5 AY735443-1|AAU08018.1| 163|Anopheles gambiae bursicon protein. 23 8.6 AY735442-1|AAU08017.1| 163|Anopheles gambiae bursicon protein. 23 8.6 >AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-signaling promoter protein. Length = 1197 Score = 25.4 bits (53), Expect = 2.1 Identities = 13/44 (29%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Frame = -3 Query: 804 ARAREIDHVKSSPKTVFNSNPLIPVEMKKI-RNTHIQR*LRWNS 676 + R + H KS PK N N ++P + + H+ R +R S Sbjct: 1032 SEGRRLSHSKSWPKGTENENYMVPPSPRPVSEELHLVRGVRLGS 1075 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 25.0 bits (52), Expect = 2.8 Identities = 12/22 (54%), Positives = 17/22 (77%) Frame = +3 Query: 519 NSCILAGLETRS*TAGAAVPVL 584 +SC L+ LET++ TAGA+V L Sbjct: 130 SSCSLSTLETQTATAGASVQSL 151 >AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. Length = 565 Score = 23.8 bits (49), Expect = 6.5 Identities = 16/43 (37%), Positives = 22/43 (51%), Gaps = 3/43 (6%) Frame = +1 Query: 247 SYRDSLQGDHPNPY---TLTKALAESIVYSHTELPVCIVRPSI 366 S D LQ NP+ TL +LA + + HTE+ +PSI Sbjct: 341 SLHDYLQKRVLNPHMLKTLAHSLASGVAHLHTEIFGTPGKPSI 383 >AY735443-1|AAU08018.1| 163|Anopheles gambiae bursicon protein. Length = 163 Score = 23.4 bits (48), Expect = 8.6 Identities = 11/34 (32%), Positives = 15/34 (44%) Frame = -1 Query: 242 PSPEVASGCIGRCCPDHGEGDTRALQYKISERCC 141 P P + CIGRC ++ Q + S CC Sbjct: 55 PKPIPSFACIGRCASYIQVSGSKIWQMERSCMCC 88 >AY735442-1|AAU08017.1| 163|Anopheles gambiae bursicon protein. Length = 163 Score = 23.4 bits (48), Expect = 8.6 Identities = 11/34 (32%), Positives = 15/34 (44%) Frame = -1 Query: 242 PSPEVASGCIGRCCPDHGEGDTRALQYKISERCC 141 P P + CIGRC ++ Q + S CC Sbjct: 55 PKPIPSFACIGRCASYIQVSGSKIWQMERSCMCC 88 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 979,562 Number of Sequences: 2352 Number of extensions: 24052 Number of successful extensions: 42 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 40 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 42 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 86902827 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -