BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30546 (784 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY047562-1|AAK77294.1| 478|Drosophila melanogaster GH07619p pro... 75 1e-13 AE014296-392|AAF47596.1| 478|Drosophila melanogaster CG1017-PA ... 75 1e-13 >AY047562-1|AAK77294.1| 478|Drosophila melanogaster GH07619p protein. Length = 478 Score = 74.5 bits (175), Expect = 1e-13 Identities = 32/43 (74%), Positives = 37/43 (86%) Frame = +3 Query: 3 LDKEEDVFKQDFSGPTLDDHFDKTVLPKVMQVKKFGRSGRTKY 131 LD+E DV K+DF+ TL+DHFDKT+LPKVMQVK FGR GRTKY Sbjct: 387 LDEENDVLKRDFAQATLEDHFDKTILPKVMQVKNFGRCGRTKY 429 Score = 46.8 bits (106), Expect = 3e-05 Identities = 23/41 (56%), Positives = 30/41 (73%), Gaps = 2/41 (4%) Frame = +1 Query: 133 THLVDQDTTEFDSAWSNETSA-ARLTN-FRGGMKQVFEKPS 249 THLVDQDTT+FDS W E+S+ + N GGM+Q F+KP+ Sbjct: 430 THLVDQDTTKFDSPWYAESSSNIKFHNEHAGGMRQQFDKPT 470 >AE014296-392|AAF47596.1| 478|Drosophila melanogaster CG1017-PA protein. Length = 478 Score = 74.5 bits (175), Expect = 1e-13 Identities = 32/43 (74%), Positives = 37/43 (86%) Frame = +3 Query: 3 LDKEEDVFKQDFSGPTLDDHFDKTVLPKVMQVKKFGRSGRTKY 131 LD+E DV K+DF+ TL+DHFDKT+LPKVMQVK FGR GRTKY Sbjct: 387 LDEENDVLKRDFAQATLEDHFDKTILPKVMQVKNFGRCGRTKY 429 Score = 46.8 bits (106), Expect = 3e-05 Identities = 23/41 (56%), Positives = 30/41 (73%), Gaps = 2/41 (4%) Frame = +1 Query: 133 THLVDQDTTEFDSAWSNETSA-ARLTN-FRGGMKQVFEKPS 249 THLVDQDTT+FDS W E+S+ + N GGM+Q F+KP+ Sbjct: 430 THLVDQDTTKFDSPWYAESSSNIKFHNEHAGGMRQQFDKPT 470 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 35,146,877 Number of Sequences: 53049 Number of extensions: 730505 Number of successful extensions: 1325 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1278 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1323 length of database: 24,988,368 effective HSP length: 84 effective length of database: 20,532,252 effective search space used: 3613676352 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -