BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30546 (784 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. 25 0.79 EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. 25 0.79 AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase ... 23 4.2 DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 22 5.6 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 22 7.4 >EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. Length = 686 Score = 25.0 bits (52), Expect = 0.79 Identities = 13/40 (32%), Positives = 22/40 (55%) Frame = +1 Query: 106 LDVPVVRSTTHLVDQDTTEFDSAWSNETSAARLTNFRGGM 225 L +P V+ + +D+ T FD + +A + NF+GGM Sbjct: 446 LQMPGVKFESVNIDKLYTYFDKCDTLINNAVAVENFKGGM 485 >EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. Length = 686 Score = 25.0 bits (52), Expect = 0.79 Identities = 13/40 (32%), Positives = 22/40 (55%) Frame = +1 Query: 106 LDVPVVRSTTHLVDQDTTEFDSAWSNETSAARLTNFRGGM 225 L +P V+ + +D+ T FD + +A + NF+GGM Sbjct: 446 LQMPGVKFESVNIDKLYTYFDKCDTLINNAVAVENFKGGM 485 >AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase protein. Length = 510 Score = 22.6 bits (46), Expect = 4.2 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = +1 Query: 202 LTNFRGGMKQVFEKPSAKGSTMFD 273 + NF+G + V +PS K FD Sbjct: 108 IENFKGTVTHVESRPSKKEGLQFD 131 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 22.2 bits (45), Expect = 5.6 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +3 Query: 186 NLSSQTD*LPRGNETSIRETFG 251 N+S D L RG + S+R FG Sbjct: 5 NISELLDNLLRGYDNSVRPDFG 26 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 21.8 bits (44), Expect = 7.4 Identities = 9/25 (36%), Positives = 10/25 (40%) Frame = -1 Query: 454 WSYQKNVFTKRVHHRNHVINNDDSL 380 W Y NV HR V DD + Sbjct: 1677 WGYHHNVNKHCTIHRTQVKETDDKI 1701 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 223,044 Number of Sequences: 438 Number of extensions: 5073 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24639531 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -