BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30545 (778 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ974163-1|ABJ52803.1| 595|Anopheles gambiae serpin 4B protein. 24 4.6 AF487781-1|AAL96668.1| 533|Anopheles gambiae cytochrome P450 CY... 24 4.6 >DQ974163-1|ABJ52803.1| 595|Anopheles gambiae serpin 4B protein. Length = 595 Score = 24.2 bits (50), Expect = 4.6 Identities = 15/54 (27%), Positives = 25/54 (46%) Frame = +2 Query: 161 IDLKINKFGTQSSRMCIFTINFKIYDVTFVLFLSTRINEQLILNVGNEKTRCTL 322 +DL++N+ GT+ I T+N V F R +L + N++T L Sbjct: 538 VDLEVNETGTEGGAATIVTLNRSGTSVVF------RAEAPFLLLIRNDQTNLPL 585 >AF487781-1|AAL96668.1| 533|Anopheles gambiae cytochrome P450 CYP9L1 protein protein. Length = 533 Score = 24.2 bits (50), Expect = 4.6 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -3 Query: 404 SDALNRESPEP*KSQMCNKYYFI 336 S+ L + SP P +MCN+ Y I Sbjct: 391 SETLRKWSPSPGTDRMCNQDYTI 413 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 715,794 Number of Sequences: 2352 Number of extensions: 12978 Number of successful extensions: 14 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 81081585 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -