BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30545 (778 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated... 22 5.5 DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monoo... 22 5.5 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 22 7.3 >DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 391 Score = 22.2 bits (45), Expect = 5.5 Identities = 7/22 (31%), Positives = 17/22 (77%) Frame = -2 Query: 180 LFIFKSISHFVVLELIGLQLRL 115 +F+F ++ FVV++++ L+ +L Sbjct: 271 MFVFAALGEFVVVKVLDLRSQL 292 >DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monooxygenase protein. Length = 499 Score = 22.2 bits (45), Expect = 5.5 Identities = 7/11 (63%), Positives = 11/11 (100%) Frame = +2 Query: 356 TFDFFKARGIL 388 TFDF+K+RG++ Sbjct: 25 TFDFWKSRGVV 35 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 21.8 bits (44), Expect = 7.3 Identities = 17/67 (25%), Positives = 29/67 (43%), Gaps = 1/67 (1%) Frame = -2 Query: 309 VFSLPTFRINCSLIRVDKNKTNVTSYILKFI-VKIHIREDCVPNLFIFKSISHFVVLELI 133 V++ R+ L VD+ N IL I + +HI + C + + HFV L Sbjct: 77 VYNRGVQRLEAMLFAVDQ--INRDEDILPGITIGVHILDTCGRDTYALNQSLHFVRASLS 134 Query: 132 GLQLRLI 112 L + ++ Sbjct: 135 NLDMSVL 141 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 194,031 Number of Sequences: 438 Number of extensions: 3799 Number of successful extensions: 7 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24396777 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -