BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30536 (785 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g08580.1 68417.m01410 microfibrillar-associated protein-relat... 88 5e-18 At5g17900.1 68418.m02099 expressed protein 88 7e-18 At2g35110.1 68415.m04307 HEM protein-related weak similarity to ... 29 2.6 At3g23780.1 68416.m02989 DNA-directed RNA polymerase family prot... 28 8.1 >At4g08580.1 68417.m01410 microfibrillar-associated protein-related similar to Microfibrillar-associated protein 1 (Associated microfibril protein) (AMF) (Swiss-Prot:P55080) [Gallus gallus] Length = 435 Score = 88.2 bits (209), Expect = 5e-18 Identities = 43/91 (47%), Positives = 59/91 (64%), Gaps = 1/91 (1%) Frame = +3 Query: 15 EDVFKQDFSGPTLDDHFDKTVLPKVMQVKKFGRSGRTKYTHLVDQDTTEFDSAW-SNETS 191 + +F++DFS PT +D DK++LPKVMQVK FGRSGRTK+THLV++DTT++ + W SN+ Sbjct: 347 DGIFQRDFSAPTGEDRLDKSILPKVMQVKHFGRSGRTKWTHLVNEDTTDWSNPWTSNDPL 406 Query: 192 AARLTNFRGGMKQVFEKPSAKGSTMFDTCQT 284 + GM KP KGS +T Sbjct: 407 REKYNKKMAGMDAPIAKP--KGSKKMKDWET 435 >At5g17900.1 68418.m02099 expressed protein Length = 435 Score = 87.8 bits (208), Expect = 7e-18 Identities = 42/83 (50%), Positives = 57/83 (68%), Gaps = 1/83 (1%) Frame = +3 Query: 15 EDVFKQDFSGPTLDDHFDKTVLPKVMQVKKFGRSGRTKYTHLVDQDTTEFDSAW-SNETS 191 + +F++DFS PT +D DK++LPKVMQVK FGRSGRTK+THLV++DTT++ + W SN+ Sbjct: 347 DGIFQRDFSAPTGEDRLDKSILPKVMQVKHFGRSGRTKWTHLVNEDTTDWSNPWTSNDPL 406 Query: 192 AARLTNFRGGMKQVFEKPSAKGS 260 + GM KP KGS Sbjct: 407 REKYNKKMAGMDAPIAKP--KGS 427 >At2g35110.1 68415.m04307 HEM protein-related weak similarity to Membrane-associated protein Hem (Dhem-2) (Swiss-Prot:P55162) [Drosophila melanogaster]; weak similarity to Nck-associated protein 1 (NAP 1) (p125Nap1) (Membrane-associated protein HEM-2) (Swiss-Prot:P55161) [Rattus norvegicus] Length = 1339 Score = 29.5 bits (63), Expect = 2.6 Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = +3 Query: 51 LDDHFDKTVLPKVMQVKKFGRSGRTK 128 L + + VLP+V++ KK +SGRTK Sbjct: 339 LHEDYQLYVLPRVLESKKMAKSGRTK 364 >At3g23780.1 68416.m02989 DNA-directed RNA polymerase family protein similar to SP|P38420 DNA-directed RNA polymerase II 135 kDa polypeptide (EC 2.7.7.6) (RNA polymerase II subunit 2) {Arabidopsis thaliana}; contains Pfam profiles PF04560: RNA polymerase Rpb2 domain 7, PF04561: RNA polymerase Rpb2 domain 2, PF04565: RNA polymerase Rpb2 domain 3, PF04566: RNA polymerase Rpb2 domain 4, PF04567: RNA polymerase Rpb2 domain 5 Length = 946 Score = 27.9 bits (59), Expect = 8.1 Identities = 10/29 (34%), Positives = 19/29 (65%) Frame = +1 Query: 4 WIKKKMFSNRTSRVLRWMIILTRQFYQRL 90 W +++++ R+ ++R MI + FYQRL Sbjct: 786 WGNERVYNGRSGEMMRSMIFMGPTFYQRL 814 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,373,248 Number of Sequences: 28952 Number of extensions: 361863 Number of successful extensions: 743 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 726 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 743 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1765546400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -