BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30526 (800 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g02870.1 68418.m00230 60S ribosomal protein L4/L1 (RPL4D) 60S... 146 1e-35 At3g09630.1 68416.m01142 60S ribosomal protein L4/L1 (RPL4A) str... 146 1e-35 At5g22640.1 68418.m02645 MORN (Membrane Occupation and Recogniti... 33 0.22 At5g07730.1 68418.m00886 expressed protein 30 2.1 At5g55100.2 68418.m06869 SWAP (Suppressor-of-White-APricot)/surp... 29 3.6 At5g55100.1 68418.m06868 SWAP (Suppressor-of-White-APricot)/surp... 29 3.6 At3g16130.1 68416.m02037 expressed protein contains Pfam profile... 29 4.7 At4g39480.1 68417.m05585 cytochrome P450 family protein contains... 28 6.3 At5g51770.1 68418.m06419 protein kinase family protein contains ... 28 8.3 At5g17650.1 68418.m02069 glycine/proline-rich protein glycine/pr... 28 8.3 At5g01010.1 68418.m00001 expressed protein 28 8.3 At2g20320.1 68415.m02373 DENN (AEX-3) domain-containing protein ... 28 8.3 At1g57750.1 68414.m06552 cytochrome P450, putative similar to cy... 28 8.3 >At5g02870.1 68418.m00230 60S ribosomal protein L4/L1 (RPL4D) 60S roibosomal protein L4, Arabidopsis thaliana, EMBL:CAA79104 Length = 407 Score = 146 bits (355), Expect = 1e-35 Identities = 65/81 (80%), Positives = 71/81 (87%) Frame = +3 Query: 15 LPFVFKAPIRPDLVNDVHVSMSKNSRQPYCVSKEAGHQTSAESWGTGRAVARIPRVRGGG 194 LP V AP+RPD+VN VH +S NSRQPY VSK+AGHQTSAESWGTGRAV+RIPRV GGG Sbjct: 30 LPDVMTAPVRPDIVNFVHAQISNNSRQPYAVSKKAGHQTSAESWGTGRAVSRIPRVPGGG 89 Query: 195 THRSGQGAFGNMCRGGRMFAP 257 THR+GQ AFGNMCRGGRMFAP Sbjct: 90 THRAGQAAFGNMCRGGRMFAP 110 Score = 63.3 bits (147), Expect = 2e-10 Identities = 41/128 (32%), Positives = 55/128 (42%) Frame = +2 Query: 254 PTKPWRRWHXXXXXXXXXXXXXXXXXXXXXXXXXQARGHIIEKIPELPLVVADKVQEINK 433 PTK WRRWH ARGH IE +PE+PLVV+D + + K Sbjct: 110 PTKIWRRWHRRVNVNMKRHAIVSAIAATAVPALVMARGHKIENVPEMPLVVSDSAEAVEK 169 Query: 434 TKQAVIFLRRLKAWSDILKVYKSQRFVLVRVKCATVVVSSVRGPLHNLQQGSGV*LAAFP 613 T A+ L+++ A+ D K S + K S +GPL + AF Sbjct: 170 TSAAIKVLKQIGAYDDAEKAKNSIGIRPGKGKMRNRRYISRKGPLVVFGTEGAKIVKAF- 228 Query: 614 QTFPGVEL 637 + PGVEL Sbjct: 229 RNLPGVEL 236 >At3g09630.1 68416.m01142 60S ribosomal protein L4/L1 (RPL4A) strong similarity to 60S ribosomal protein L1 GB:P49691 Length = 406 Score = 146 bits (355), Expect = 1e-35 Identities = 65/81 (80%), Positives = 71/81 (87%) Frame = +3 Query: 15 LPFVFKAPIRPDLVNDVHVSMSKNSRQPYCVSKEAGHQTSAESWGTGRAVARIPRVRGGG 194 LP V AP+RPD+VN VH +S NSRQPY VSK+AGHQTSAESWGTGRAV+RIPRV GGG Sbjct: 29 LPDVMTAPVRPDIVNFVHAQISNNSRQPYAVSKKAGHQTSAESWGTGRAVSRIPRVPGGG 88 Query: 195 THRSGQGAFGNMCRGGRMFAP 257 THR+GQ AFGNMCRGGRMFAP Sbjct: 89 THRAGQAAFGNMCRGGRMFAP 109 Score = 63.3 bits (147), Expect = 2e-10 Identities = 43/129 (33%), Positives = 59/129 (45%), Gaps = 1/129 (0%) Frame = +2 Query: 254 PTKPWRRWHXXXXXXXXXXXXXXXXXXXXXXXXXQARGHIIEKIPELPLVVADKVQEINK 433 PTK WRRWH ARGH IE +PE+PLVV+D + + K Sbjct: 109 PTKIWRRWHRRVNVNMKRHAIVSAIAATAVPALVMARGHKIENVPEMPLVVSDSAEAVEK 168 Query: 434 TKQAVIFLRRLKAWSDILKVYKSQRFVLVRVKCATVVVSSVRGPLHNL-QQGSGV*LAAF 610 T A+ L+++ A+ D K S + K S +GPL +GS + + AF Sbjct: 169 TSAAIKVLKQIGAYDDAEKAKNSIGIRPGKGKMRNRRYISRKGPLVVYGTEGSKI-VKAF 227 Query: 611 PQTFPGVEL 637 + PGVEL Sbjct: 228 -RNLPGVEL 235 >At5g22640.1 68418.m02645 MORN (Membrane Occupation and Recognition Nexus) repeat-containing protein contains Pfam profile PF02493: MORN repeat Length = 871 Score = 33.1 bits (72), Expect = 0.22 Identities = 24/74 (32%), Positives = 37/74 (50%), Gaps = 1/74 (1%) Frame = +1 Query: 511 RAGKGKMRNRRRIQRKGTPS*SSTRIRGLTRGLSANIPRCGA-PGMLTSLNLPEAGLRGR 687 R GK+ NR +QR S S +++ L+R LS N + P +S L ++GL Sbjct: 784 RLKMGKVANRGCVQRSYGSSRSQSQLMSLSRLLSCNASSSSSPPDSSSSEYLKDSGLWET 843 Query: 688 PIFGTFSSILEFQV 729 P+ G S +L Q+ Sbjct: 844 PV-GDMSVVLSLQI 856 >At5g07730.1 68418.m00886 expressed protein Length = 264 Score = 29.9 bits (64), Expect = 2.1 Identities = 16/49 (32%), Positives = 24/49 (48%), Gaps = 1/49 (2%) Frame = -2 Query: 586 SLLKIMKGSPYAGYDDGCAFYPYQHETLRLV-HLKDIRPCLEAPQEDDS 443 S + +++ SP DDG F P HE L + + + LE+P E S Sbjct: 21 SSMVVIRESPIFAKDDGVVFPPIYHENLHVASSVYGVDRYLESPSESSS 69 >At5g55100.2 68418.m06869 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein contains Pfam domain PF01805: Surp module Length = 844 Score = 29.1 bits (62), Expect = 3.6 Identities = 12/41 (29%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = -3 Query: 252 RTYVHHDTCYRRHPDRTY-EYHHHGHAEFGRQHVQYPMIQH 133 R++ H + +H D + E+HHH H R+H ++H Sbjct: 735 RSHHHRSRKHEKHRDSSDDEHHHHRHRSSRRKHEDSSDVEH 775 >At5g55100.1 68418.m06868 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein contains Pfam domain PF01805: Surp module Length = 843 Score = 29.1 bits (62), Expect = 3.6 Identities = 12/41 (29%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = -3 Query: 252 RTYVHHDTCYRRHPDRTY-EYHHHGHAEFGRQHVQYPMIQH 133 R++ H + +H D + E+HHH H R+H ++H Sbjct: 735 RSHHHRSRKHEKHRDSSDDEHHHHRHRSSRRKHEDSSDVEH 775 >At3g16130.1 68416.m02037 expressed protein contains Pfam profile PF03759: Domain of unknown function (DUF315) Length = 576 Score = 28.7 bits (61), Expect = 4.7 Identities = 17/51 (33%), Positives = 26/51 (50%), Gaps = 4/51 (7%) Frame = -1 Query: 797 LEWVFLPNEPRKRGS-KTLARKCGTW---NSKIDENVPKIGLPRSPASGRF 657 ++W NEPRK S K L + + N+K + +G RSP +GR+ Sbjct: 525 MQWNIETNEPRKEKSDKKLLTRVSSMIMSNNKKTTYLESLGTTRSPTAGRY 575 >At4g39480.1 68417.m05585 cytochrome P450 family protein contains Pfam profile: PF00067 cytochrome P450 Length = 989 Score = 28.3 bits (60), Expect = 6.3 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +3 Query: 12 PLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCV 107 P+PF K+P +PD++ H + NSR +C+ Sbjct: 384 PVPFNHKSPAKPDVLPSGH-KVKANSRILFCL 414 >At5g51770.1 68418.m06419 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 654 Score = 27.9 bits (59), Expect = 8.3 Identities = 19/47 (40%), Positives = 26/47 (55%), Gaps = 3/47 (6%) Frame = +3 Query: 198 HRSGQGAFGNMCRGGRMFAPRSPGG---VGTVASTSDSGERPWRQPL 329 +R GQG FG++ RG +P S GG V + S S GER ++ L Sbjct: 94 NRLGQGGFGSVFRG--TLSPSSGGGNVAVKVMDSGSLQGEREFQNEL 138 >At5g17650.1 68418.m02069 glycine/proline-rich protein glycine/proline-rich protein GPRP - Arabidopsis thaliana, EMBL:X84315 Length = 173 Score = 27.9 bits (59), Expect = 8.3 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = -3 Query: 240 HHDTCYRRHPDRTYEYHHHGHAEF 169 HH Y H Y Y +HGH +F Sbjct: 122 HHHGHYGHHHGHGYGYGYHGHGKF 145 >At5g01010.1 68418.m00001 expressed protein Length = 409 Score = 27.9 bits (59), Expect = 8.3 Identities = 16/45 (35%), Positives = 28/45 (62%), Gaps = 1/45 (2%) Frame = -1 Query: 137 STGLVTSLLAHAVGLPRVLGHRNVNIIDQVR-TDGRLEHEREGLG 6 +TG+ +L+ + VG+P+VL ++ I Q+ DG +E +RE G Sbjct: 203 ATGVYKTLVKYLVGVPQVL----LDFIRQINDDDGPMEEQRERYG 243 >At2g20320.1 68415.m02373 DENN (AEX-3) domain-containing protein contains Pfam domain PF02141: DENN (AEX-3) domain Length = 976 Score = 27.9 bits (59), Expect = 8.3 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = -2 Query: 799 FWNGCSFPMNPEKGGQKPLPENAEPGIPRLTKTFQRL 689 ++NG P +P +G ++ E PG R T +FQRL Sbjct: 247 YFNGPVLPQSPTQGHRRTQSEIGTPG-HRRTNSFQRL 282 >At1g57750.1 68414.m06552 cytochrome P450, putative similar to cytochrome P450 GI:4688670 from [Catharanthus roseus] Length = 497 Score = 27.9 bits (59), Expect = 8.3 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = +3 Query: 12 PLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCV 107 PLPF K+P +PD++ H + NS+ C+ Sbjct: 367 PLPFNHKSPAKPDVLPSGH-KVDANSKIVICI 397 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,214,029 Number of Sequences: 28952 Number of extensions: 451320 Number of successful extensions: 1533 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 1403 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1515 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1814318400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -