BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30525 (509 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF003151-13|AAK18907.1| 159|Caenorhabditis elegans Ribosomal pr... 88 4e-18 Z75525-5|CAA99764.1| 162|Caenorhabditis elegans Hypothetical pr... 49 2e-06 >AF003151-13|AAK18907.1| 159|Caenorhabditis elegans Ribosomal protein, large subunitprotein 24.1 protein. Length = 159 Score = 87.8 bits (208), Expect = 4e-18 Identities = 39/77 (50%), Positives = 53/77 (68%), Gaps = 2/77 (2%) Frame = +1 Query: 25 MKIGLCAYSGYKIYPGHGKTMVKVDGKTFTFLNSKCEAAHLMRRNPRKVTWTVLYRRKFK 204 MK+ C YSGYKI+PGHGK +V+ DGK FL+ K +RRNPR + WTVLYR K K Sbjct: 1 MKVETCVYSGYKIHPGHGKRLVRTDGKVQIFLSGKALKGAKLRRNPRDIRWTVLYRIKNK 60 Query: 205 KGQ--EEEQAKKRTRRT 249 KG +E+ +K+T+++ Sbjct: 61 KGTHGQEQVTRKKTKKS 77 >Z75525-5|CAA99764.1| 162|Caenorhabditis elegans Hypothetical protein C03D6.8 protein. Length = 162 Score = 49.2 bits (112), Expect = 2e-06 Identities = 22/57 (38%), Positives = 30/57 (52%) Frame = +1 Query: 25 MKIGLCAYSGYKIYPGHGKTMVKVDGKTFTFLNSKCEAAHLMRRNPRKVTWTVLYRR 195 M+I C + IYPGHG V+ D F F S+C ++NPRK+ +T RR Sbjct: 1 MRIEKCYFCSSPIYPGHGIQFVRNDSTVFKFCRSRCNKLFKKKKNPRKLRFTKAARR 57 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,954,030 Number of Sequences: 27780 Number of extensions: 189116 Number of successful extensions: 424 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 418 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 424 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 988489374 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -